KEGG   Camelus ferus (Wild Bactrian camel): 102508242
Entry
102508242         CDS       T02979                                 

Gene name
CTBP1
Definition
(RefSeq) C-terminal-binding protein 1 isoform X1
  KO
K04496  C-terminal binding protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04310  Wnt signaling pathway
cfr04330  Notch signaling pathway
cfr05200  Pathways in cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102508242 (CTBP1)
   04330 Notch signaling pathway
    102508242 (CTBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102508242 (CTBP1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102508242 (CTBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102508242 (CTBP1)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Macropinocytosis
   Others
    102508242 (CTBP1)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh Cellsynth_D
Other DBs
NCBI-GeneID: 102508242
NCBI-ProteinID: XP_032347970
LinkDB
Position
2
AA seq 517 aa
MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGII
GLERPFRGHRGGEWRSTCYSCGHRGAAPHSDATRGPRKGRGPKAAAKHAESDLRSSPTFT
KVETCFGFSGFSERGADAGRVGQAVALRAKAFGFSVLFYDPYLPDGTERALGLQRVSTLQ
DLLFHSDCVSLHCGLNEHNHHLVNDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRI
RGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIP
DSLKNCVNKDHLTAATHWASMDPAVVHPELNGAAYSRYPPGVVGVAPSGIPAAVEGLVPS
AMSLSHGLPPVPHPPHAPSPGQTVKPEAERDHASDQL
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgggcagctcgcacttgctcaacaagggcctgccgctcggcgtccgacccccgatcatg
aacgggcccctgcacccccggcccctggtggcactgctggacggccgggactgcacggtg
gagatgcccatcctgaaggacgtggccacggtggccttctgtgacgcgcagtccacgcag
gagatccacgagaaggtgctgaacgaggccgtgggggcactgatgtatcacaccatcaca
ctgaccagggaggacctggagaagttcaaggcccttcggataatcgtccgaatcggtagc
ggttttgataacatcgacatcaagtcggctggggatttaggcatcgctgtctgcaacgtg
ccggccgcgtccgtggaggagactgccgactccaccatgtgccatatcctcaacctgtac
cgccggaccacctggctgcaccaggcactgcgggaaggcacgcgggtccagagtgtcgag
cagatccgggaagtggcctccggagccgccaggatccgcggagagaccttgggcatcatt
ggactagagcgtcccttccgtggccacaggggcggagagtggagaagcacctgctacagc
tgtggtcaccgcggcgctgctccacattcagatgctacccgcgggccccggaaaggaagg
ggccccaaggcagctgcaaaacatgctgaaagcgatttgcgctcttcacctactttcaca
aaagtggaaacctgcttcgggttttctggattctcggaacggggcgctgacgcaggccgc
gtagggcaggcagtggctctgcgggccaaggcctttggcttcagcgtgctcttctatgac
ccctacctgccggacggcacagagcgggcgctggggctgcagcgcgtcagcaccctgcag
gacctgctcttccacagcgactgtgtgagcctgcactgcggcctgaacgagcacaaccac
cacctcgtcaacgacttcaccgtcaagcagatgagacaaggggccttcctggtgaacaca
gcccgaggcggcctggtggatgagaaggcgctggcccaggccctgaaggaggggcggatc
cgtggcgcagccctggatgtgcacgagtcggagcccttcagctttagccagggccccctg
aaggacgcacccaacctgatctgcaccccgcacgcggcctggtacagcgagcaggcgtcc
atcgagatgcgcgaggaggcggctcgggagatccgcagagccatcacaggccggatcccc
gacagcctgaagaactgtgtgaacaaggaccacctgacggccgccacccactgggccagc
atggaccctgctgtggtgcaccccgagctcaatggggccgcctacagcaggtaccctccg
ggtgtggtgggcgtggcccccagcggcatcccggccgccgtggagggcctcgtccctagc
gccatgtccctgtcgcacggcctgccccccgtaccccacccaccccatgcgccttctccc
ggccagaccgtcaagcccgaggcggagagagaccacgcgagtgaccagttgtag

KEGG   Camelus ferus (Wild Bactrian camel): 102519579
Entry
102519579         CDS       T02979                                 

Gene name
CTBP2
Definition
(RefSeq) LOW QUALITY PROTEIN: C-terminal-binding protein 2
  KO
K04496  C-terminal binding protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04310  Wnt signaling pathway
cfr04330  Notch signaling pathway
cfr05200  Pathways in cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102519579 (CTBP2)
   04330 Notch signaling pathway
    102519579 (CTBP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102519579 (CTBP2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102519579 (CTBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102519579 (CTBP2)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Macropinocytosis
   Others
    102519579 (CTBP2)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Other DBs
NCBI-GeneID: 102519579
NCBI-ProteinID: XP_032346579
LinkDB
Position
11
AA seq 983 aa
MPVPSRHINIGRSQSWDAAGWYEGPWEIAEAPGRRSSLTDGGGEGPWSEQLNPGLQDVTM
PGAAGPCLYREALYSSMAGRKSSVPDFTFYDSRQAAMSARGALLPRDYYSDPAGATRVPR
EPRHHRNLGVSQPLPGYGALGSRMTWDPVQGRVPALQDTGHLYRDPGGKTIPQGQRSQSR
ASSPARYTGEPADSRYGVEAPVYPASQVYNHVGERSVDSAPARQAAPTCLVVDPSMAAAS
GVGTGAAPGTLNRGYGPAQESVHPRMAYENCEADLSAFQGPGGGRRSVMPEFLAFLRAEG
VAEATLVALLQQGFDSPAVLATMEDADIKCVAPNLGQARVLSRLASSCRTEMQLRRQGRT
RSSSFSHRSELHGDLSALGAPALPPQPVGPLQAASPRTGDPARRPSSAPSQHLLETATYS
APGVGTQAPHFPSNSGYSSPTPCALTARLGPTYLPQAGVPLTNPGPAAPLHPGPRTAYST
AYTVPMELLKRERGVAASPLPSPHGSPQLLRKTGVPAEPSTLPSASQSLHSPHSPYQKVA
RRTGAPIIVSTMLAPEPSIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDA
QSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIA
VCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGET
LGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLH
CNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEP
FSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFF
VTTAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAH
PSQAPSPNQPTKHGDNREHPNEQ
NT seq 2952 nt   +upstreamnt  +downstreamnt
atgccggttcccagcaggcatataaatattggccgatctcagagctgggatgctgccggg
tggtacgagggcccctgggagatcgctgaggctccagggaggaggagctccctgacagat
ggaggcggagagggaccttggtccgagcagctgaaccccgggcttcaggatgtcaccatg
ccaggggctgcagggccctgcctctaccgggaggccctctacagctccatggccggaagg
aagagctccgttcctgacttcaccttttacgacagcagacaggcggcgatgtcagctcgc
ggagccctgctaccgcgggattactacagtgatccagctggagccacccgggtgcccaga
gagcctcggcaccatcgcaacctgggagtcagccagccactgcccggttatggagcactg
ggcagcaggatgacgtgggatccagtgcaaggccgggtccctgccctgcaggacaccggt
cacctgtaccgggatcccggtggtaaaacgatccctcaggggcagcgatcgcagagcagg
gcctcgtcgcccgcgcggtacacaggggagccggccgacagcaggtacggggtggaggcg
cccgtctaccccgccagtcaggtctacaaccacgtgggcgagagatctgtggattctgcc
cctgccaggcaggcagcccccacctgcctggtcgtggaccccagcatggctgctgcctcc
ggggttggcacaggggcagctccaggcaccctgaaccgaggctacgggcctgcccaggag
agtgtccaccccaggatggcttacgagaattgtgaggccgacctgtccgccttccagggg
cctggcggcggcaggaggagtgtgatgcctgagttcctggccttcctgcgggcggagggc
gtggcagaggccacgctggtggccctgctgcagcagggcttcgactccccagccgtcctg
gccacgatggaggatgccgacatcaagtgcgtggcgcccaacctcggccaggcacgcgtc
ctgagccgcctggccagcagctgcaggacggagatgcagctgcgccggcagggccggaca
cgctctagcagcttcagccaccggagcgagcttcacggtgacttgtctgctctgggtgcc
ccggccttgccgccccagccggtgggacccttgcaggcggcgtcccctcggactggagac
ccggctcgccgcccctccagtgcgccatcccagcacctcctggagacagctacctactct
gccccgggggtgggcacccaagccccccactttccgtccaactctgggtacagctctccc
actccgtgtgccctgacagcgcggctgggccccacgtacctgccgcaggccggagtgccc
ttgactaacccgggccctgccgcgccacttcacccaggccccagaacagcctattccacc
gcatacacggtgcccatggaactgctgaagcgggagcgcggcgtggccgcgtcccccctg
cccagcccccacggcagcccccagctcctgcggaagactggtgtccccgcggagccctcc
accctgccgtcagccagccagagcctgcactcgccccactcgccctaccagaaggtggcc
cggcggacgggggctcccatcatcgtgtccaccatgcttgcaccggaaccaagtatccgc
ccccagatcatgaacggccccctgcacccccgccccctggtggcgctgctcgacggcaga
gactgcaccgtagagatgccgatcctgaaggacctggccaccgtggccttctgtgacgca
cagtccacccaggagatccacgagaaggttttaaacgaggctgtcggcgccatgatgtac
cacaccatcaccctcaccagggaggacctggagaagttcaaggccttgagagtaatcgtg
cggataggcagcggctacgacaacgtggacatcaaggcggcaggcgagctcgggatcgcc
gtgtgcaacatcccgtccgcagcagtggaggagacggccgactccaccatctgccacatc
ctcaatctctaccggcggaacacgtggctgtaccaggcgctgcgggaaggcacgcgggta
cagagcgtcgagcagatccgggaggtggcgtcgggagcagcccgcatccgtggggagacg
ctgggcctcattggcttcggtcgcacggggcaggcggtcgctgttcgagccaaggccttc
ggattcagcgtcatattttatgacccctacttgcaggacgggatagagcggtccctgggc
gtccagagggtctacaccctgcaggacttactgtatcagagcgactgcgtctccttgcac
tgcaatctcaacgaacataaccaccacctcatcaacgactttaccataaagcagatgagg
caaggagcatttctagtgaacgcggcccgcggcggactggtggacgagaaagccttagcc
caagccctcaaggaaggccggatacgaggggcggccctcgacgtgcacgagtcggagcct
ttcagctttgctcagggtcccttgaaagatgcaccgaatctcatttgtacgccccacacg
gcctggtatagtgagcaagcctccctggagatgagggaggccgctgccacggagatccgt
cgggcaatcacaggtcgcatcccagaaagcttaagaaactgtgtgaacaaggaattcttc
gtcacaacagctccctggtcagtaatagatcagcaagcaatccatccagagctcaatggt
gccacgtacagatacccgccaggcattgtgggcgtggctccgggaggacttcctgcagcc
atggaagggatcattcccggaggcatcccggtgacccacaacctccccacagtggcacat
ccttcccaagctccctctcccaaccagcccacaaaacacggggacaatcgagagcacccc
aacgagcaatag

DBGET integrated database retrieval system