KEGG   Camelus ferus (Wild Bactrian camel): 102508482
Entry
102508482         CDS       T02979                                 

Gene name
GADD45A
Definition
(RefSeq) LOW QUALITY PROTEIN: growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04210  Apoptosis
cfr04218  Cellular senescence
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102508482 (GADD45A)
   04064 NF-kappa B signaling pathway
    102508482 (GADD45A)
   04068 FoxO signaling pathway
    102508482 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102508482 (GADD45A)
   04210 Apoptosis
    102508482 (GADD45A)
   04115 p53 signaling pathway
    102508482 (GADD45A)
   04218 Cellular senescence
    102508482 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102508482 (GADD45A)
   05202 Transcriptional misregulation in cancer
    102508482 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102508482 (GADD45A)
   05212 Pancreatic cancer
    102508482 (GADD45A)
   05225 Hepatocellular carcinoma
    102508482 (GADD45A)
   05226 Gastric cancer
    102508482 (GADD45A)
   05214 Glioma
    102508482 (GADD45A)
   05216 Thyroid cancer
    102508482 (GADD45A)
   05220 Chronic myeloid leukemia
    102508482 (GADD45A)
   05217 Basal cell carcinoma
    102508482 (GADD45A)
   05218 Melanoma
    102508482 (GADD45A)
   05213 Endometrial cancer
    102508482 (GADD45A)
   05224 Breast cancer
    102508482 (GADD45A)
   05222 Small cell lung cancer
    102508482 (GADD45A)
   05223 Non-small cell lung cancer
    102508482 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102508482 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    102508482 (GADD45A)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102508482 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102508482 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102508482
NCBI-ProteinID: XP_032350437
LinkDB
Position
13
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctcagcaaagctctgagtcagcgcaccatcaccgtcggggtg
tacgaggcggccaaactgctcaatgtcgaccccgataacgtggtgctgtgtctgctggcg
gcggacgaggacgacgacagggacgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcgacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgcttctggagaccgacgcgggccccgcggcgagcgagggcgcagagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatcacagtggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagccgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

KEGG   Camelus ferus (Wild Bactrian camel): 102516207
Entry
102516207         CDS       T02979                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04210  Apoptosis
cfr04218  Cellular senescence
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102516207 (GADD45B)
   04064 NF-kappa B signaling pathway
    102516207 (GADD45B)
   04068 FoxO signaling pathway
    102516207 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102516207 (GADD45B)
   04210 Apoptosis
    102516207 (GADD45B)
   04115 p53 signaling pathway
    102516207 (GADD45B)
   04218 Cellular senescence
    102516207 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102516207 (GADD45B)
   05202 Transcriptional misregulation in cancer
    102516207 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102516207 (GADD45B)
   05212 Pancreatic cancer
    102516207 (GADD45B)
   05225 Hepatocellular carcinoma
    102516207 (GADD45B)
   05226 Gastric cancer
    102516207 (GADD45B)
   05214 Glioma
    102516207 (GADD45B)
   05216 Thyroid cancer
    102516207 (GADD45B)
   05220 Chronic myeloid leukemia
    102516207 (GADD45B)
   05217 Basal cell carcinoma
    102516207 (GADD45B)
   05218 Melanoma
    102516207 (GADD45B)
   05213 Endometrial cancer
    102516207 (GADD45B)
   05224 Breast cancer
    102516207 (GADD45B)
   05222 Small cell lung cancer
    102516207 (GADD45B)
   05223 Non-small cell lung cancer
    102516207 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102516207 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    102516207 (GADD45B)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102516207 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102516207 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102516207
NCBI-ProteinID: XP_006186549
LinkDB
Position
22
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRENNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgagc
gccgcggtggaggagctgctggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggtcctgtgcctcctggcc
attgatgaggaggaagaagatgacatcgccctgcagatccacttcacgctcatccagtct
ttctgctgtgacaacgacatcgacatcgtgcgggtgtcgggcatgcagcggctggcacag
ctgctgggcgagccagccgagacccagggcaccaccgaggctcgggacctgcactgcctc
ctggtcacgaaccctcacacagatgcctggaaaagccacggtctggtggaggtggccagt
tactgtgaagagagccgggagaacaaccagtgggtcccctacatctccctccaggagcgc
tga

KEGG   Camelus ferus (Wild Bactrian camel): 116660720
Entry
116660720         CDS       T02979                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04210  Apoptosis
cfr04218  Cellular senescence
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116660720 (GADD45G)
   04064 NF-kappa B signaling pathway
    116660720 (GADD45G)
   04068 FoxO signaling pathway
    116660720 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    116660720 (GADD45G)
   04210 Apoptosis
    116660720 (GADD45G)
   04115 p53 signaling pathway
    116660720 (GADD45G)
   04218 Cellular senescence
    116660720 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116660720 (GADD45G)
   05202 Transcriptional misregulation in cancer
    116660720 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116660720 (GADD45G)
   05212 Pancreatic cancer
    116660720 (GADD45G)
   05225 Hepatocellular carcinoma
    116660720 (GADD45G)
   05226 Gastric cancer
    116660720 (GADD45G)
   05214 Glioma
    116660720 (GADD45G)
   05216 Thyroid cancer
    116660720 (GADD45G)
   05220 Chronic myeloid leukemia
    116660720 (GADD45G)
   05217 Basal cell carcinoma
    116660720 (GADD45G)
   05218 Melanoma
    116660720 (GADD45G)
   05213 Endometrial cancer
    116660720 (GADD45G)
   05224 Breast cancer
    116660720 (GADD45G)
   05222 Small cell lung cancer
    116660720 (GADD45G)
   05223 Non-small cell lung cancer
    116660720 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    116660720 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    116660720 (GADD45G)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     116660720 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     116660720 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 116660720
NCBI-ProteinID: XP_032326697
LinkDB
Position
31
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggatacggttccagaaagcactgccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctgtcggcgcagcgccagggctgcctcacc
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaacgtgaccttctgc
gtgctggccgccgacgaggaggacgagggcgacatcgcgctgcagatccacttcactctg
atccaggcgttttgctgcgagaacgacatcgacatcgtgcgcgtgggcgacgtgcagagg
ctggctgcgatcgtgggcgccggcgacgaggcgggcgcgccgggggacctgcactgcatc
ctcatctcgaaccccaatgaggacgcgtggaaggaccctgccttggagaagctcagcctg
ttctgcgaggagagtcgcagcgtcaacgactgggtgcccagtatcaccctcccggagtga

DBGET integrated database retrieval system