KEGG   Camelus ferus (Wild Bactrian camel): 102508732Help
Entry
102508732         CDS       T02979                                 

Gene name
ALPI
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00730  Thiamine metabolism
cfr00790  Folate biosynthesis
cfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    102508732 (ALPI)
   00790 Folate biosynthesis
    102508732 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102508732 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfr00537]
    102508732 (ALPI)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102508732 (ALPI)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102508732 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfr00537]
 Enzymes
  102508732 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 102508732
NCBI-ProteinID: XP_006191215
LinkDB All DBs
Position
Un
AA seq 531 aa AA seqDB search
MQGAWVLLLLLGLRLRLSLSFIPAEEEDPAFWNRQAAQALDTAKNLQHIQTAAKNLIIFL
GDGMGVPTVTATRILKGQMNGKLGPETPLVMDQFPYLALSKTYNVDRQVPDSAGTSTAYL
CGVKANYKTIGVSAAARYDQCNTTRGNEVTSVMNRAKKAGKSVGIVTTSRVQHASPAGTY
AHTVNRNWYSDADLSADAKTQGCQDIATQLINNMDIDVILGGGRVYMFPEGTPDPEYPQD
ANQNGVRQDKRNLVQEWQAKHQGAQYVWNRTALMQATNDPSVTHLMGLFEPLDMKYEVQR
NLATDPSLAEMTEAALRLLSRNPLGFYLFVEGGRIDHGHHENVAYRAPVMFDTAVDKANQ
LTSEKDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSKASDGKSYTSILYGNGPGFALSG
GTRPDVSDSQSEDPTYRQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMA
FAACIEPYTDCSLPTPMGKCILLSLEMLVTLLLLLQTAALLRLGHCPDPVQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcagggggcctgggtgctgctgctgctactggggctgaggcttcggctctcccttagc
ttcatcccagctgaggaggaagatccagctttctggaaccgccaggcagcccaggccctg
gacactgctaagaatctgcaacacatccagacagctgccaagaatctcattatcttcttg
ggggatgggatgggagtgcctacagtgacagccactcggatcctgaaggggcagatgaat
ggcaagctgggacctgagacacccctggtcatggaccaattcccatacctggctctgtcc
aagacttacaacgtggacagacaggtgccagacagtgcaggcacctccactgcctacttg
tgcggggtcaaggccaactataagaccattggtgtaagtgcagctgcccgctatgaccag
tgcaacacgacacgtggcaatgaggtcacctctgtgatgaaccgagccaagaaagcaggg
aagtccgtgggaatcgtaaccacctcgagggtgcagcatgcctctccagccggcacctac
gcacacacagtgaaccgcaactggtactcagatgccgacctgtctgctgatgcgaagacg
cagggctgccaggacatcgccacgcagctcatcaacaacatggacattgacgtgatcctg
ggtggaggccgagtgtacatgtttcctgaggggaccccagaccctgagtacccacaggat
gccaatcagaatggagtccggcaggataagcgaaacctggtgcaggagtggcaggccaag
caccagggtgcccagtatgtgtggaaccgcacggcactcatgcaggcaaccaatgacccc
agtgtaacacatcttatgggcctctttgagcctttagacatgaaatatgaagtccagcgc
aacttggccacagacccatccctggcagagatgacagaggcagccctgcgcctgctgagc
aggaacccccttggcttctacctcttcgtagagggaggccgcattgaccacggtcaccat
gaaaacgtagcttatagggcacccgtcatgtttgacactgccgttgacaaggccaaccag
ctcacaagcgaaaaggacacactgatccttgtcactgctgaccactctcacgtcttctct
tttggtggctacacactgcgtggaacctccattttcggactggcccccagcaaggcctct
gatggcaagtcctacacgtccatcctttatggcaatggccctggctttgcgctcagcgga
ggcacacggcccgacgtcagtgacagccagagcgaggaccccacgtaccggcagcaggcg
gccgtgcccctgtccagcgagacccacggcggcgaggacgtggcggtgttcgcgcgcggc
ccgcaggcgcacctggtgcacggcgtgcaggagcagagcttcgtggcgcacgtcatggcc
ttcgccgcctgcatcgagccctacaccgactgcagcctgccgacccccatgggaaagtgc
attttgctttcactagaaatgttggtgaccctgctgctgctgctgcagacagctgctctg
ctcagactcgggcattgcccagatcctgttcagtga

DBGET integrated database retrieval system