KEGG   Camelus ferus (Wild Bactrian camel): 102508972
Entry
102508972         CDS       T02979                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04066  HIF-1 signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04640  Hematopoietic cell lineage
cfr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102508972 (EPO)
   04066 HIF-1 signaling pathway
    102508972 (EPO)
   04151 PI3K-Akt signaling pathway
    102508972 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102508972 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102508972 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102508972 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102508972 (EPO)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  CSF and other factors
   102508972 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102508972
NCBI-ProteinID: XP_032315345
LinkDB
Position
18
AA seq 194 aa
MGAREWPALLLLVSLLLLPLGLPVLGAPQRLICDSRVLERYILEAREAENATMGCAEGCS
FSENITVPDTKVNFYAWKRMEVAQQAVEVWQGLVLLSEAILQGQALLANSSQPSEVLQLH
VDKAVSGLRSLTSLLRALGAQKEAIPLPDAASSSAAPLRTFTVDTLCKLFRIYSNFLRGK
LTLYTGEACRRGDR
NT seq 585 nt   +upstreamnt  +downstreamnt
atgggggcgcgcgaatggcctgccctgctgcttctggtgtccttgctgctgcttcctctg
ggcctcccggtcctgggcgccccccaacgcctcatctgtgacagccgagttttggagagg
tacatcctggaggccagggaggccgaaaatgccacgatgggctgtgccgaaggctgcagc
ttcagtgagaatatcaccgtcccagacaccaaagttaacttctatgcctggaagaggatg
gaggtcgcgcagcaggctgtggaagtctggcagggcctggtcctgctctctgaagccatc
ctgcagggccaggccctgttggccaactcctcccagccatctgaggtcctgcagctgcat
gtggacaaagctgttagcggcctgcgcagcctcacctccctgcttcgggcgctgggagcc
cagaaggaagccatcccccttccagatgcagcctcctcctccgctgccccactccgaaca
ttcactgttgatactttgtgcaaacttttccgaatctactccaatttcctgcggggaaag
ctgacgctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system