KEGG   Camelus ferus (Wild Bactrian camel): 102509293Help
Entry
102509293         CDS       T02979                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00512  Mucin type O-glycan biosynthesis
cfr01100  Metabolic pathways
Module
cfr_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102509293 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfr01003]
    102509293 (GALNT9)
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102509293 (GALNT9)
Glycosyltransferases [BR:cfr01003]
 O-Glycan biosynthesis
  Mucin-type
   102509293 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ricin_B_lectin Glycos_transf_2 Glyco_transf_7C Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 102509293
NCBI-ProteinID: XP_014406347
LinkDB All DBs
Position
Un
AA seq 545 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRLQDRSEGLVQIVRSADRRGRSRHAKAGALAE
REAILQRLDHLEEVVYNQLNGLAKPIGLMEGPGGLGQGGMAATLHEDSQETERKYEEFGY
NAQLSDRISLDRTIPDYRPQKCRQMTYSDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SQLLKEVILVDDNSDNGPSPPSREDRRRIVLPAIDNIKYDTFEVQQYASAAHGYNWGLWC
MYIIPPQDWLDRGDEAAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMRV
WQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDGFKSHVYMAWNIPM
TNPGVDFGDVSERLALRQRLKCRSFKWYLDNVYPEMRTYNDTLTYGEVRNSKASGYCLDQ
GAEDDDRAILYPCHGMSSQEGWPWCLGGPCLDAPPLPFGAARPNSRRQPCPGPPDAHAPH
TEALGQDPWADCFPSAQGGPIVSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWTIRNWI
KPGRH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatcaaaactttgctgacggtcaacatcctggtgttcgtgggc
atcatcctcttttcggtgtactgccgcctgcaggaccgctcagaggggctggtgcagatt
gtgcgcagcgccgaccgccgggggcgcagccggcacgccaaggcgggcgcgctggcggag
cgcgaagccatcctgcagcgcctggaccacctggaggaggtagtctacaaccaactgaac
ggcctcgccaagcccattggtctgatggaggggccgggcggcctgggccagggtggcatg
gcggccacgctgcatgaggacagccaggagacggagaggaagtacgaggaatttgggtac
aacgcacagctcagcgaccgcatctccctggacaggaccatccccgactacaggccccaa
aagtgcagacagatgacctactcggacgacctgccccagatctccgtggtgttcatcttt
gtcaatgaagccctctcggtaatcctgcgctccgtccacagcgtggtcaaccacacgccc
tcccagctcctcaaggaggtcatcctggtggacgacaatagcgataacgggccgagcccg
ccctcacgggaggaccgccggcgcatcgtcctgccggccatcgacaacatcaagtacgac
acgttcgaggtgcagcagtacgccagcgccgcccacggctacaactggggcctctggtgc
atgtacatcatcccgccccaggactggctggaccgcggcgacgaggcggcgcccatcagg
accccggccatgatcggctgctccttcgtggtggaccgggagtacttcggggacatcggc
ctgctggacccgggcatggaggtgtacggcggggagaacattgagctgggcatgagggtg
tggcagtgcggcggcagcatggaggtgctaccctgctcccgcgtggcccacatcgagcgc
accaagaagccctacaacaacgacatcgactactacgccaagcgcaacgccctgcgggct
gccgaggtgtggatggacggcttcaagtcccacgtgtacatggcctggaacatccccatg
actaacccgggggtggacttcggggacgtgtctgagcggctggccctgcgccagaggctg
aaatgccgcagcttcaagtggtacctggacaacgtgtacccagagatgaggacctacaac
gacacgctgacgtacggagaggtgagaaacagcaaagccagcggctactgcttggaccag
ggggcggaagatgatgaccgggccatcctgtacccctgccatgggatgtcctcccaggaa
ggctggccctggtgcctaggtggcccctgcctcgatgccccaccacttcccttcggggcc
gcgaggccgaactcccgacgccagccctgcccggggccacctgacgcccacgccccccac
acggaagccctcggacaggacccctgggctgactgtttcccttctgcgcagggtggcccc
atcgtgagcagagacacgggccggtgcctggaggtggagatgtccaaggatgccaacttc
gggctgcggctggtggtgcagaggtgctcggggcagaagtggacgatcagaaactggatc
aagccgggtcggcactga

DBGET integrated database retrieval system