KEGG   Camelus ferus (Wild Bactrian camel): 102509438
Entry
102509438         CDS       T02979                                 

Gene name
BCR
Definition
(RefSeq) breakpoint cluster region protein isoform X1
  KO
K08878  breakpoint cluster region protein [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr05200  Pathways in cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102509438 (BCR)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102509438 (BCR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102509438 (BCR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102509438 (BCR)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102509438 (BCR)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: Other
  BCR family
   102509438 (BCR)
Membrane trafficking [BR:cfr04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    102509438 (BCR)
SSDB
Motif
Pfam: RhoGAP Bcr-Abl_Oligo RhoGEF PH_19 C2 PH IQ_SEC7_PH PH_5 SKA1
Other DBs
NCBI-GeneID: 102509438
NCBI-ProteinID: XP_032327547
LinkDB
Position
32
AA seq 1275 aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQPPDGAPEPRAPRPQPAPADGADPPPADESESRPDGEGS
PGKARPAAARRPGTAAPADRDDRGPPTSVAALRSNFERIRKGPGQPAAADAEKPFYVNVE
FHHERGLVKVNDKDVSDRISSLGTQAMQMERKRSQQGVGPGPGDAPRPPYRGRASESSCG
LDGDYEDAELNPRFLKDNLINADGGGRPPWPPLEYQPYQSIYVGGMMVEGEGKGPLQLSQ
STSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RIFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQGQVVVSEATIVGVRKTGQIWPNDGDS
LSGRVPQDGAFHGDADASFGTPPGYGCAADLAEEQRRHQDGLPYIDDSPSSSPHLGSKGR
GSRDAPEATKATELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQP
VLTSQQIETIFFKVPELYEVHKDFYDGLLPRVQQWGRQQCVGDLFQKLASQLGVYRAFVD
NYGVAMETAEKCCQANAQFAEISENLRARSNKDAKDQMTKNSLETLLYKPVDRVTRSTLV
LHDLLKHTPSSHPDYPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMV
ELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQTVDESEAAPNI
PLVLDEELDAMKMKISQIKSDIQREKRANKGSKAIERLRKKLSEQESMLLLMSPSMAFRV
HSRNGKSYTFLISSDYERAEWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHSIP
LTINKEDDESPGLYGFLNVIVHSATGFKQSSSLYCTLEVDSFGYFVNKAKTRVYRDTAEP
NWNEEFEIELEGSQTLRILCYEKCYNKTKLTKEDGESTDRIMGKGQVQLDPQALQDRDWQ
RTIIAMNGIEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVE
EIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELP
EPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVN
KMSLHNLATVFGPTLLRPSEKESKLPANPSQPISMTDSWSLEVMSQVQVLLYFLQLEAIP
APDSKRQSILFSTEV
NT seq 3828 nt   +upstreamnt  +downstreamnt
atggtggacccggtgggcttcgccgaggcgtggaaggcgcagttcccggactcggagccg
ccgcgcatggagctgcgctcagtgggcgacatcgagcaggagctagagcgttgcaaggcc
tccatccggcgcctggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgctgctggccaaggagaagaagagctacgaccggcagcgctggggcttccggcgcgcc
gctcagccccccgacggcgcccccgagccccgcgcgccgcgcccccagcccgcgcccgcc
gacggcgccgaccctccgcccgccgacgagtccgagtcccggccagatggagagggttcc
ccgggcaaagccaggcccgcggccgctcgcaggcccgggaccgctgctcccgcggaccgc
gacgaccgggggccccccaccagcgtggcggctctgcgctccaacttcgagaggatccgc
aagggcccgggccagccagcggcggcggacgccgagaagcccttctacgtgaacgtcgag
ttccaccacgagcgcggcctggtgaaggtcaacgacaaagacgtctcggatcgcatcagc
tccctgggcacccaggccatgcagatggagcgcaagaggtcccagcagggcgtcgggccc
ggcccgggggatgcgcccaggcccccctaccgcgggcgcgcctccgagagcagctgcggc
ctcgacggcgactatgaggacgccgagctgaacccgcgcttcctgaaggacaacctgatc
aacgccgacggcggcggcaggcccccctggccgcccctggagtaccagccctaccagagc
atctacgtcgggggcatgatggtggaaggggagggcaagggcccgctccagctcagccag
agcacttcggagcaggagaagcgccttacctggccccgcaggtcctactcccctcggagc
tttgaggacagcggaggcggctacacgccagactgcagctccaacgagaacctcacctcc
agcgaggaggacttctcctcgggccagtccagccgcgtgtccccgagccccaccacctac
cgcatattccgagacaagagccgctcgccctcgcagaactctcagcagtcctttgacagc
agcagccccccgacgccgcagtgccagaagcggcaccggcagggccaggtggtcgtgtcc
gaggccaccatcgtgggcgtccgcaagacggggcagatctggcccaacgatggggacagc
ttgtcgggcagggtgcctcaggatggcgccttccatggagacgcagatgcgtcgttcgga
acgccaccggggtacggctgtgctgcggacctggctgaggagcagcgccggcaccaggac
gggctgccctacatcgacgactcgccctcctcctcgccccacctgggcagcaagggcagg
ggcagccgggacgcaccggaggccaccaaagcgactgagctggacctggaaaagggcttg
gagatgaggaaatgggtcctgtccggaatcctggctagcgaggagacatacctgagccac
ctggaggcactgctgctgcccatgaagcctttgaaggccgctgccaccacctctcagccg
gtgctgacaagccagcagatcgagaccatcttcttcaaagtgcccgagctctacgaggtc
cacaaggacttctatgatgggctcctcccccgcgtgcagcagtggggccgccagcagtgc
gtgggtgacctcttccagaagctggccagccagctgggtgtgtaccgggcctttgtggac
aactacggagttgccatggaaacggccgagaagtgctgtcaggccaacgctcagtttgca
gaaatctccgagaacctgagagccagaagcaacaaggatgccaaggaccagatgaccaag
aactctttggaaacccttctttacaagcctgtggaccgggtgacgcggagcacactggtc
ctgcatgacttgctgaaacacactccatccagccaccccgactaccctttgctgcaggac
gccctccgaatctcccagaacttcctgtccagcatcaacgaggagatcacaccccgccgg
cagtccatgaccgtgaagaagggggagcaccggcagctgctgaaggacagcttcatggtg
gagctggtggagggcgcccgcaagctgcgccacgtcttcctgttcaccgacctgctcctg
tgcaccaagctcaagaagcagagcggaggcaaaacccagcagtacgactgcaagtggtac
atcccgctcacggatctcagcttccagacggtggacgagtcggaggctgcgcccaacatc
cccctggtgctggacgaggagctggatgccatgaagatgaagatttcccagatcaagagt
gacatccagagagagaagagagcgaacaagggcagcaaggccattgagaggctgaggaag
aagctctcggagcaggagtccatgcttctgctcatgtcgccgagcatggccttcagggtg
cacagccgcaacggcaagagttacacgttcctgatctcatccgactatgagcgtgccgag
tggcgggagaacatccgggagcagcagaagaaatgtttcaagagcttctccctgacttcc
gtggagctccagatgctgaccaactcgtgcgtcaaactccagaccgtccacagcatcccg
ctgaccatcaacaaagaagacgatgaatctcctgggctctatgggttcctgaatgtcatc
gtccactctgccaccggctttaagcagagttcaagtctgtactgcaccctggaggtggac
tcctttggctactttgtaaataaagccaagacgcgtgtctacagggacacagctgagccc
aactggaatgaggagtttgagatcgagctggaaggctcccagactttgaggatactgtgt
tatgagaagtgttacaacaaaacgaagctcaccaaggaagacggcgagagcacagacagg
atcatggggaagggccaggtccagctggatccccaggccctgcaggacagagactggcag
cggaccatcatcgccatgaacgggatcgaggtgaagctctcagtcaagttcaccagcagg
gagttcagcctgaagaggatgccttcccgaaaacagacgggtgtcttcggagtcaagatt
gccgtggtcaccaagagggagcggtccaaggtgccctacatcgtgcgccagtgcgtggag
gagatcgagcgccggggcatggaggaggtgggcatctaccgtgtgtccggcgtggccacg
gacatccaggcgctgaaggcggcctttgacgtcaataacaaggacgtgtcggtgatgatg
agcgagatggatgtgaacgccatcgccgggacgctgaagctctacttccgagagctgccc
gagcccctcttcacggacgagttctaccccaacttcgccgagggcatcgccctctcagac
ccagttgcgaaggagagctgcatgcttaacttactgctgtcactgccagaggccaacctg
ctcaccttcctcttccttctggaccacctgaaaagggtggcggagaaggagacggtgaac
aagatgtccctgcacaacctcgccacagtgttcggccccacgctgctgcggccctcggag
aaggagagcaaactccctgccaaccccagccagcccatctccatgaccgacagctggtcc
ctggaggtcatgtcccaggtccaggtgctactgtacttcctgcagctggaggccatcccc
gccccggacagcaagagacagagcatcctgttctccacggaagtctag

KEGG   Camelus ferus (Wild Bactrian camel): 102519310
Entry
102519310         CDS       T02979                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X2
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04012  ErbB signaling pathway
cfr04014  Ras signaling pathway
cfr04110  Cell cycle
cfr04360  Axon guidance
cfr04722  Neurotrophin signaling pathway
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05220  Chronic myeloid leukemia
cfr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102519310 (ABL1)
   04014 Ras signaling pathway
    102519310 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102519310 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102519310 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    102519310 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102519310 (ABL1)
   05206 MicroRNAs in cancer
    102519310 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102519310 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102519310 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102519310 (ABL1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102519310 (ABL1)
Protein kinases [BR:cfr01001]
 Non-receptor tyrosine kinases
  ABL family
   102519310 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 102519310
NCBI-ProteinID: XP_006181989
LinkDB
Position
4
AA seq 1148 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEVHQAFETMFQESSISDEVEKELGKKGVRGVASP
LLQAPELPTKTRTSRRAAEHKDSPEGPEMPHSKGPGETDPLDHEPAVSPLLPRKERGPQD
GSLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERKGASEEEGREI
SNGALVLAPSDAAEPAKSPKPSSGAGVPNGAFRESGGAGFRSPHLWKKSSTLTSSRLAAS
EEESGGSSSKRFLRSCSASCMPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRASENRSDQVTRGTVTPPPRLVKKTEEAADEVFKDTAESSPGSSPPTLTPKLLRKQ
VVATPSSGLPHREEAGKASALGTLAEPVPPSSRAGPGASGGTSKAPAEESRVRRHKPSSE
SPGRDKGKLSKLKPAPPPPPPASVGKAGKPSQSPTQEAAGEAGASGKAKSVALGVDAVNS
DAAKPSQPGDGAKKPVLPSMPKPQSSTKPAGTPTSPAPAPSTLPSASSAQAGDQPSSTAF
IPLISTRVSLRKTRQPPERIASGTITKGVVLDGTEALCLAISKNSEQMASHSAVLEAGKN
LYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVK
EISDIVQR
NT seq 3447 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggccaagtttgcctgccctg
cactttatcaaaggagcagggaagaaggaatcatcgaggcatgggggtccacactgcaat
gtttttgtggaacatgaagcccttcagaggccagtagcatctgacttcgaaccccaaggt
ctgagtgaagcagctcgttggaactctaaggaaaatcttcttgctggtcccagtgaaaat
gaccccaaccttttcgttgcactgtatgattttgtggccagtggggataacactttaagc
ataactaaaggtgaaaagctccgagtcttaggctacaatcacaatggggaatggtgtgaa
gcccaaaccaaaaatggccaagggtgggtcccgagcaactacatcacaccagtcaacagt
ctggagaaacattcctggtaccatgggcccgtgtcccgcaacgccgctgagtacctgctg
agcagcgggatcaacggcagcttcttggttcgggagagcgagagcagccctgggcagagg
tccatctcactgagatatgaggggagggtgtaccactacaggatcaacactgcttctgat
ggcaagctctacgtgtcctcagagagccgcttcaacaccttggccgagctggttcatcat
cactcaactgtggcagacgggctcatcaccaccctccactacccggcccccaagcgcaac
aaacccaccgtctacggcgtgtcccccaactacgacaagtgggagatggagcgcacagac
atcacgatgaagcacaagctggggggaggccagtacggggaggtgtatgaaggcgtgtgg
aagaagtacagcctgacggtggctgtgaagaccctgaaggaggataccatggaggtggaa
gagttcttgaaagaagctgcagtaatgaaagagatcaagcaccctaacctagtgcagctg
ctcggggtctgcacccgggagcccccattctatataatcactgagttcatgacctatggg
aacctgctggattacctgagagagtgtaaccggcaggaggtgaacgctgtggtgctgctg
tacatggccactcagatctcatcagccatggagtacctggagaagaaaaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggaaaaccacttggtgaaggtggctgat
ttcggcctgagcaggttaatgacaggggacacctacacagcccacgccggggccaagttc
ccaatcaagtggactgcgcctgagagcctggcctacaacaagttctccatcaagtcggac
gtctgggcatttggagtgttgctttgggaaattgctacctatggcatgtcaccttaccca
ggaattgacctgtcccaggtgtatgagctgctagagaaggactatcgcatggagcgccca
gaaggctgcccagagaaggtctacgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgctgaagtccaccaagcctttgaaaccatgttccaggaatccagc
atatcagatgaagtggaaaaggaactggggaagaaaggcgtacgaggggttgcaagtcct
ctgctgcaggccccggagttgcccaccaagacgagaacctccaggagagctgccgaacac
aaagattcccccgaggggcctgagatgccccactccaagggccccggagagactgatcct
ctggaccacgagcccgctgtatctccactgctccctcgaaaagagcgaggtcctcaggat
ggcagcctaaatgaagatgagcgccttctccccaaagacaagaagaccaacttgttcagc
gccttgatcaagaagaagaagaaaacagccccaacccctcccaaacgcagcagctccttc
cgggagatggacggccagcccgagcgcaaaggggccagcgaggaagaaggccgtgaaatc
agcaacggggcgctggttctcgcaccctcggacgcagccgagccagccaagtccccaaag
cccagcagcggggctggcgtccccaatggagccttccgggagtcagggggtgcaggcttc
aggtctccccacctatggaaaaagtccagcacgctgaccagcagccgattagcagccagt
gaagaggagagtggtggcagctccagtaagcgcttcctgagatcctgctctgcctcctgc
atgccccacggggccaaggacacagagtggcggtcggtcacgctgcctcgggatctgcag
tccacggggagacagtttgactcatccacctttggagggcacaagagtgagaagccggct
ctgcctcggaagcgggcaagtgagaacaggtctgatcaggtgaccagaggcacagtcact
cccccacccaggctggtgaagaagaccgaggaagcagccgatgaggtcttcaaggacaca
gccgagtccagcccgggctccagccctcccactctgactccaaaactcctccggaagcag
gttgtggccacgccttcctctggccttccccacagggaagaggctgggaaggctagtgcc
ttggggacacttgctgagccggtgccccccagcagcagagcagggccaggtgcatctgga
gggaccagcaaggcccctgccgaggagtctagagtgaggaggcacaagccctcctccgag
tccccagggagagacaaggggaagttgtccaagctcaaacccgccccaccacccccacca
ccagcatctgttgggaaagccgggaagccctctcagagcccgacccaggaagcagccggg
gaggcaggtgccagtggaaaagcaaaatccgtggctctgggtgtggatgctgtgaacagt
gatgctgccaaacccagccagccgggagatggtgccaaaaagcccgtgctcccgtccatg
ccaaagccacagtcgtccaccaagccggcggggactccgaccagcccagcccccgctccc
tccacgttgccctcagcatcctctgcccaagcaggggaccagccgtcctccaccgccttc
atccctctcatatcgacccgcgtgtctcttcggaaaacccgccagcctcccgagcggatt
gccagtggcaccatcaccaagggtgtggtgctggatggcaccgaggccctgtgccttgcc
atctccaagaactccgagcagatggccagccatagcgccgtgctagaggctggcaaaaac
ctctacactttctgtgtgagctacgtggactccatccaacagatgaggaacaagtttgcc
ttccgagaggccatcaacaaactggagaataatcttcgggagcttcagatctgcccagcg
acagcagggagtggcccggcggccactcaggacttcagcaaactcctcagctccgtgaaa
gagatcagtgacatcgtacagaggtag

DBGET integrated database retrieval system