KEGG   Camelus ferus (Wild Bactrian camel): 102509504
Entry
102509504         CDS       T02979                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04020  Calcium signaling pathway
cfr04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102509504 (CACNA1E)
   04020 Calcium signaling pathway
    102509504 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102509504 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfr04040]
    102509504 (CACNA1E)
Ion channels [BR:cfr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102509504 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102509504
NCBI-ProteinID: XP_032319484
LinkDB
Position
21
AA seq 2451 aa
MRGLSPGRRLPEPALCPAAGGSPEARAAGRRRRHVLALPEEEAWRPQHCALLEADASDEA
GMLPASPRAAAASGFDNFFPVQEGEGPGWEGGSSPFLPISPEVMKRRRGGLIDQRDIIKA
HEAHKMQSTPQARRKEWEMARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGPAAAYKQS
KAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIAN
CIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNV
MDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLL
QIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDW
IGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFV
LNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNA
GTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKE
RLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLE
MSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKI
TKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDT
FPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIA
VDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPR
SSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNA
HPSLYRRPRPIEGLALGLGLERCEEERVSRGGSLKRDGGSLSSALDSQRSPLSLGKREPP
WLARPCHGNCDPTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKEPSSASRSRSA
SQERSLDEDAPAEEERDCEPRGGHGGKEPMIHKERSQDLRRTNSLMVSRGSGLAGALNEA
DTPLVLPQPELEVEKDAALTEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCVTANTDK
AATESTSVTVAIPDVDPLVDSTVVHISNKTDGEASPLKEAEIKEEEEGGEKQQQQKEKRE
TGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSER
NKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANA
LGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFI
FAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWAL
LTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALI
IITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEY
TIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTW
NIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQ
SFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATG
EAWQEIMLSCLGEKGCEPDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVI
MDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCP
SKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAI
WPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRM
EPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQE
QQSLEPEVSELESAQPSNHGIYLPSDTQEHAGSGRASSMPRLTMDPQVVTDPSSMRRSFS
TIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLGSDSGHKSDTHRSGGRE
RGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESS
IPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLMRHSGSISPPADGSEGGSPLASQTLES
SDAGLPESSNPRHAPQGLRPSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGR
SNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 7356 nt   +upstreamnt  +downstreamnt
atgcgtggactgagcccaggccgcaggctgcccgagcccgccctctgtccggctgcaggc
gggagccctgaggccagggccgcgggccgccgccgccgccacgtcctggccctgcccgag
gaggaggcatggcggccccagcactgcgccctgctcgaggccgacgcctcggacgaggcg
gggatgctgccggcctccccgcgcgccgccgccgccagcggcttcgacaacttcttcccg
gtgcaggagggcgagggcccgggctgggagggcggctccagccccttcctcccgatcagc
cccgaggtgatgaagcggcggcgagggggtctcatcgaccagcgcgacatcatcaaggcc
cacgaggcgcacaagatgcagagcaccccgcaggcgcggcgcaaggagtgggagatggct
cgcttcggggaggcagtggtcgccaggccagggtcgggcgatggagactcggaccagagc
aggaaccggcaaggaacccccgtgccggcctccgggccagcggccgcctacaagcagtcg
aaagcgcagagggcgcggactatggctttgtacaaccctattcccgtccggcagaactgt
ttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaatacgcc
aagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcattgccaac
tgcatcgtcttggccctggagcagcaccttcctgaggatgacaagacccccatgtcccgc
agactggagaagacggaaccgtatttcattgggatcttttgctttgaagccgggatcaaa
atcgtggccctggggttcatcttccataagggctcgtacctccgcaatggctggaatgtc
atggacttcatcgtggtcctcagtggcatcctggccactgcgggaacccacttcaacaca
catgtggacctgaggaccctccgggccgtgcgtgtcctgaggcccctgaagctcgtgtca
gggattcctagcttgcagattgtgttgaagtccatcatgaaggccatggtgccccttctg
cagatcggccttctgctcttctttgccatcctgatgtttgcaatcattggcttggagttc
tacagtgggaagttgcaccgagcatgcttcatgaacaattcaggtattctagaaggattt
gacccccctcacccatgcggcgtgcagggctgcccagctggttatgaatgcagggactgg
atcggccccaacgatgggatcacccagttcgataacatcctttttgccgtgctgactgtc
ttccagtgcatcaccatggaagggtggaccactgtgctgtacaacaccaatgatgcctta
ggagccacctggaactggctgtacttcattcccctcatcatcattggatccttctttgtt
ctcaacctcgtcctgggagtgctttccggggaatttgccaaagagagagagagagtggag
aaccggagagctttcatgaaactgcggcgccagcaacagattgagcgcgagctgaacggg
taccgcgcctggatagacaaagccgaggaagtcatgcttgctgaagaaaataaaaatgcc
ggaacatcagccttagaagtgcttcgaagggcaaccatcaaaaggagccggacggaggcc
atgacacgagactccagcgatgagcactgtgtcgacatctcctccgtgggcacacctttg
gcccgggccagcatcaaaagtgcaaaggtggacggggcctcctatttccggcacaaggag
aggcttctgcgaatctctattcgccacatggttaaatcccaggtgttttactggatcgtg
ctgagccttgtggctctcaacaccgcctgcgtggccatcgtccatcacaaccagccccag
tggctcacccacctcctctactatgcagaatttttgtttctgggactcttcctcttggag
atgtccctgaagatgtacggcatggggcctcgcctttactttcactcttcattcaactgc
tttgattttggggtcacagtgggcagcatctttgaagtggtctgggcaatcttcagacct
ggtacatcttttggaatcagtgtcttgcgagctcttcggcttctgagaatatttaaaata
accaagtactgggcatccctgcggaatttggtggtctccttgatgagttccatgaagtcc
attatcagtttgctctttctcctcttcctcttcatcgtcgtctttgctctcctaggaatg
cagctgtttggaggccggttcaactttaatgacgggactccttcagcaaactttgacacc
ttccctgcagccatcatgactgtattccagatcctgacgggggaggactggaacgaggtc
atgtacaacggaatccgctcccagggcggggtcagctcaggcatgtggtccgctatctac
ttcattgtgctcaccttgttcggaaactacacgctgctgaatgtgttcttggccatcgct
gtggacaatctggccaatgcccaggaactgaccaaggatgaacaggaagaagaggaggcc
ttcaaccagaagcacgcgctgcagaaggccaaggaggtcagcccgatgtctgcgcccaac
atgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgggagccacgc
agcagccacctgagggagcggaggcgccggcaccacatgtcggtgtgggagcagcgcacc
agccagctgaggaggcacatgcagatgtccagccaggaggccctcaacaaggaggaggcc
ccgcccatgaaccccctcaaccccctcaaccccctgagccccctcaacccactcaatgcc
catcccagcctgtaccggagaccccggcccatcgagggcctggccctgggcctgggtctg
gagcgatgtgaggaagagcgcgtcagccgtggggggtccctcaagcgggacggggggagc
ctgtcgagcgccctggacagccagaggagccccctgtccctgggcaagcgggagccgcca
tggctggccaggccctgtcatgggaactgtgaccccacccagcaggaggctggtggtgga
gagaccgtggtgacctttgaggaccgggccaggcacaggcagagccagcggcgcagccgg
caccgccgtgtcaggacggagggcaaggagccctcctccgcctcccggagcaggtctgcc
agccaggagcggagtctggatgaagacgcgcctgccgaggaggagagggactgtgagccc
aggggcggccatgggggcaaggagcccatgatccacaaagagcgatcccaggacctaagg
agaaccaacagtctgatggtgtccagaggttccgggctggcaggagcgctcaatgaggca
gacacacccctcgtcctgccccaaccagagctggaagtggagaaggatgccgcgctgaca
gagcaggagccagagggcagcagtgagcaagccctgctgggggacgtgcagctggacatg
ggccgggtcatcagccagagcgagcccgacctctcctgtgtcacagccaacacagacaag
gctgccaccgagagcaccagcgtcaccgtcgccatccccgacgtagaccccttggtggac
tcgaccgtggtgcacattagcaacaagactgatggagaagccagtccgttgaaggaagca
gagatcaaggaggaggaggaggggggggagaagcagcagcagcagaaggagaagcgtgag
acgggcaaagccatggtgccgcacagctccatgttcatcttcagcaccaccaaccccatc
cgcagggcctgccactacatcgtgaacctgcgctacttcgagatgtgcatcctcctggtg
atcgcagccagcagcatcgccctggcagccgaggaccccgtcctgaccaactcggagcgc
aacaaagtgctgaggtactttgactatgttttcaccggcgtgttcacctttgagatggtt
ataaagatgatcgaccagggcctgatcctgcaggacgggtcctacttccgggacctgtgg
aacatcctggacttcgtggtggtggtcggtgcgttggtggcctttgctttggcgaatgct
ttgggaaccaacaaggggcgtgacatcaagacgatcaagtcgctgcgggtgctccgggtg
ctgaggccactgaagaccatcaagcgcctgcccaagctcaaggccgtcttcgactgtgtg
gtgacctccttgaagaacgtctttaacatcctcattgtctataagctcttcatgtttatc
tttgctgtcatcgcagttcagctcttcaagggcaagttcttttactgcacggacagctcc
aaggacaccgagaaggagtgcataggcaactacgtcgatcatgagaaaaacaagatggag
gtgaaaggccgagaatggaagcgccacgagttccactatgacaacatcatctgggccctg
ctgaccctcttcaccgtctccacgggggaagggtggcctcaagtcttgcagcactccgtc
gacgtgaccgaggaagaccggggcccgagccgcagcaaccgcatggagatgtccatcttc
tacgtggtctacttcgtggtcttccctttcttcttcgtcaacatcttcgtggctctcatc
atcatcaccttccaggagcagggggacaagatgatggaggagtgcagcctggaaaagaat
gagagggcgtgcatcgacttcgccatcagtgccaagccgctcacccgctacatgccccag
aacagacacaccttccagtaccgcgtctggcacttcgtcgtgtctccgtcctttgagtac
accatcatggccatgatcgccttgaacaccgtcgtgctgatgatgaagtactactctgct
ccctgcacctatgaactggccctgaagtacctgaatatcgccttcaccatggtgttttcc
ctggaatgtgtcctaaagatcattgcatttggcttcttgaactatttccgagacacctgg
aacatctttgacttcatcaccgtgatcggcagcatcacagaaattatcctgacagacagc
aagctggtgaacaccagtggcttcaacatgagctttctgaagctcttccgagccgcccgc
ctcatcaagcttctgcgccagggctacaccatccgaattttactctggaccttcgtgcag
tccttcaaggccctcccctacgtctgccttttgatcgccatgcttttcttcatctatgcc
atcattgggatgcaggtgtttggaaacatcaaattagacgaggagagtcatattaaccgg
cacaacaacttccggagtttctttgggtccctcatgctcctcttcaggagtgccaccggg
gaggcctggcaggagataatgctgtcgtgcctcggggagaaaggctgtgagccggacacc
accgcgccgtcggggcagagcgagagcgagcgctgcggcaccgacctggcctacgtgtac
tttgtctccttcatcttcttctgctccttcctgatgctcaacctgttcgtggccgtcatc
atggacaacttcgagtacctgactcgggactcgtccatcctggggcctcaccacctggac
gagtttgtccgtgtctgggcggagtacgacagagctgcgtgtggccgcatccattacact
gagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgtccc
tccaaggtggcatataagagactggtcctgatgaacatgccagtggctgaggacatgacc
gtccacttcacgtccacacttatggctctgatccggacagctctggacattaaaatcgcc
aaaggtggcgcagacaggcagcagctagactcggagctgcagaaggagaccctggccatc
tggccccacctctcccagaagatgctcgacctgctcgtgcccatgcccaaagcctctgac
ctaaccgtgggcaaaatctatgcagcgatgatgatcatggactactataaacagagtaag
gtgaagaagcagaggcagcagctggaggagcagaaaaacgcacccatgttccagcgcatg
gagccctcatctctgcctcaggagatcattgctaatgccaaagccctgccttacctccag
caggaccccgtttcaggcctgagtggccggagtggatacccttcgatgagtccactctcc
ccgcaggaaatattccagttggcttgtatggacccagccgatgatggacagttccaggaa
cagcagtctctggagccagaggttagtgaattagaaagcgcgcagccctctaaccatggc
atctaccttccttcggacacccaggagcatgcgggatcggggagggcgtcctctatgcca
cgcctgactatggatccccaggtggtgacggaccctagctccatgagacgctcattttcc
actatccgggacaagcgttcaaactcctcgtggctagaggagttctccatggagcgaagc
agcgaaaacacgtacaagtcgcgccgccggagctaccactcctcgctgaggctgtcagcc
caccgcctgggctccgactctggccacaagtccgacacccaccgctcagggggcagagag
cggggacgatcgaaagagcggaagcaccttctgtcccctgacgtgtcccgctgcaactcc
gaggagcgagggacccaggccgactgggagtccccagagcgccgtcagtcccggtctccc
agtgagggcaggtcacagacccccaaccgacagggcacggggtccctgagcgaaagctcc
atcccttccgtctctgacaccagtaccccaagacgaagtcgtcggcagctcccccctgtc
cctcccaagcctcggcccctcctttcctacagctccctgatgagacacagtggaagcatc
tccccacctgctgatggaagcgagggtggctccccactggcctcccaaactctggagagc
agcgacgccggcctgcctgagtcttccaatccgcggcacgcgccgcagggcctgcgcccc
tccccacagcgctacatctccgagccctacctggccctgcacgaagactcgcacgcctcg
gactgcggcgaggaggagacgctcaccttcgaagccgccgtggctaccagcctgggccgc
tccaacaccatcggctcggccccgcccctgcggcacagctggcagatgcccaacgggcac
tatcggcggcggaggcgcggggggcctggaccaggcatgatgtgtggcgctgtcagcgac
ctcctgagtgacacagaagaggacgacaaatgctag

DBGET integrated database retrieval system