KEGG   Camelus ferus (Wild Bactrian camel): 102509586Help
Entry
102509586         CDS       T02979                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00590  Arachidonic acid metabolism
cfr01100  Metabolic pathways
cfr04064  NF-kappa B signaling pathway
cfr04370  VEGF signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04657  IL-17 signaling pathway
cfr04668  TNF signaling pathway
cfr04723  Retrograde endocannabinoid signaling
cfr04726  Serotonergic synapse
cfr04913  Ovarian steroidogenesis
cfr04921  Oxytocin signaling pathway
cfr04923  Regulation of lipolysis in adipocytes
cfr05140  Leishmaniasis
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05200  Pathways in cancer
cfr05204  Chemical carcinogenesis
cfr05206  MicroRNAs in cancer
cfr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102509586 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102509586 (PTGS2)
   04064 NF-kappa B signaling pathway
    102509586 (PTGS2)
   04668 TNF signaling pathway
    102509586 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102509586 (PTGS2)
   04657 IL-17 signaling pathway
    102509586 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102509586 (PTGS2)
   04913 Ovarian Steroidogenesis
    102509586 (PTGS2)
   04921 Oxytocin signaling pathway
    102509586 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    102509586 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102509586 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    102509586 (PTGS2)
   05206 MicroRNAs in cancer
    102509586 (PTGS2)
   05204 Chemical carcinogenesis
    102509586 (PTGS2)
   05222 Small cell lung cancer
    102509586 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    102509586 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102509586 (PTGS2)
   05165 Human papillomavirus infection
    102509586 (PTGS2)
   05140 Leishmaniasis
    102509586 (PTGS2)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102509586 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102509586
NCBI-ProteinID: XP_006185596
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCGAANPCCSNPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TKIKLFLKPTPNTVHYILTHFKGIWNIVNNISFLRNMIMKYVLISRSHLIDSPPTYNAHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGRKELPDSKEVVEKLLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLNHGVDLNHVYGESLERQHKLRLFKDGKMKY
QVIGGEVYPPTVKDTQVKMIYPPHVPEHLQFAVGQELFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDSFQIGDQEYNYQQFIYNNSILLEHGVTQFVESFSRQIAGRV
AGGRNLPAAVQTVAKASIDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDVMELYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctctgcgccgccctggcgctctgcggtgcagcaaatcct
tgctgttccaacccatgccagaatcgaggtgtatgtatgagcgtaggatttgaccagtat
aagtgtgactgtacccgaacaggattctatggtgaaaactgttcaacacccgaatttctg
acaaaaataaaattattcctgaaaccgactccaaacacagtgcactacatacttacccat
ttcaagggaatctggaacattgtcaataacatttccttcctgcgaaatatgattatgaaa
tatgtgttgatatcaagatcacatctgattgacagcccaccaacttacaatgcacactat
ggctataaaagctgggaagccttttctaatctctcctattatacaagagctcttcctcct
gtggctgacgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattca
aaagaagttgtggaaaaattacttctgagaagaaagttcatccctgacccccagggtaca
aatatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcat
aagcgaggaccagctttcaccaaaggactgaaccatggggtggacttaaatcatgtttat
ggtgaatctttggagagacagcataaattacgtcttttcaaggatggaaaaatgaaatat
caggtaattggtggagaggtgtatcctccaacagtcaaagatactcaggtcaagatgatc
taccctcctcatgttcctgaacacctgcagtttgctgtggggcaggagctctttggtctg
gtgcctggtctgatgatgtacgccacaatctggctgcgggaacacaatagagtgtgtgat
gtgcttaagcaggagcatccagaatgggatgatgagcggttgttccagacgagcaggctc
atactgataggagaaactattaagattgtgattgaagactatgtgcagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctacttttcaaccaacaattccagtaccaa
aaccgtattgctgctgaatttaacacactctaccactggcatccccttctgcctgacagc
tttcagattggtgaccaagagtacaactatcagcagtttatctacaacaactctatctta
ctagaacatggtgtaacccagtttgttgaatcattcagcaggcaaattgctggaagggtt
gctggtggtaggaatctgccagctgcagtacagacagtagcaaaggcctcaatcgaccag
agcagagagatgaaataccagtcttttaatgagtaccgcaaacgatttctactgaagccc
tatgaatcatttgaagaacttacaggagagaaggaaatggctgcagagttagaagctctc
tatggtgacattgatgtcatggaactgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggggagaccatggtagaagctggagcaccattctccttgaaaggactg
atgggtaatcctatatgttctcctgagtactggaagcccagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcaataatgtgaaaggc
tgtccttttacctcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagttcttcccactctggactagatgatatcaaccccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system