KEGG   Camelus ferus (Wild Bactrian camel): 102509745
Entry
102509745         CDS       T02979                                 

Gene name
GOLGA2
Definition
(RefSeq) golgin subfamily A member 2
  KO
K20358  golgin subfamily A member 2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102509745 (GOLGA2)
Membrane trafficking [BR:cfr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    102509745 (GOLGA2)
SSDB
Motif
Pfam: GOLGA2L5 GM130_C
Other DBs
NCBI-GeneID: 102509745
NCBI-ProteinID: XP_032334412
LinkDB
Position
4
AA seq 1021 aa
MSEETRQSKLAAAKKKLREYQQKNSPGVPAGAKKKRKIKNGSSPEATTSGGCPSPKDIQD
ILKVLVSDLNRSNGVAIPPLDKWKAPKDHAAPVSPSADDTMSPGGVTSPSASPPRVTSMA
STQNHDVENGPLTMDESTSFSSTESLRQLSQQLNGLVSESTSYINGEGLSSHNIKELESR
YQELSVALDSSNLKNKQLSSKIEELKQENQEALDQLEKEKKGFEQKLAKEQGALREQLQV
HIQTIGILVSEKSELQSALAHTQQAARQKAGESEDLANRLQSSRQRVGELERTLSAISAQ
QKQADRSNKELTKERDALKLELYKHNKNNEDLKQQNLELEEKLRVMVSEKAAIQLGTDEL
QKKLEMSELLLQQFSNQPTHGSSEQLQQALEDRAQLETHVQLLKDSLQQLKMERDLYVAN
MKEENAIWQQKMEQMSEQVCKLREEKEHSMSQVQELEASLAELRSQMAACPPQESPEGPS
EAEQLLQEEAEQLHKELESLAGQLKEQVKDNESLSRLNQEQEQRLLELERAAEEWGDQAE
ERKQILESMQNDRTTISRALSQNRELKEQLAELQNGFVRLTNENMEITCALQSEQHVKKE
LAKKLSQLQEKLAELKEKVEAKNQEAQGLEQQRDQYLNHLQQYVAAYQQHVAAYQQLASE
KELLHKQVLLQTQLMDRLQHEEVQDKMAMEMAHQALQETQGLLEAANQENQQLQAQLKII
AAPGEGDGPDSEEQDEEAPRPKLSMPEDLESREAMVAFCNSALASAEEEKARLREQLKEQ
KLRCQRLAHLANPSQDGVEKEAQAPGTREGSVPAETHQALQEAMDKLQGQFTKIMQEKVD
LKERVEELEHRCIQLSGETDTIGEYIALYQNQRAVLQERHRKKEEYISRLAQDKEEMKVK
LLELQELVSRLMGERNECYGKFLAAQNPAGEPTTAPSAPQELGTTDNQGGLREVSLVDNM
EPTQGQALVGQTAPENLTAQQIMQLLREIQNPREYPGLGSNSCIPFFYRADENDQVKITV
V
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgtcggaagaaacccgacagagcaaattggctgcggccaagaaaaagttaagagaatat
cagcagaagaacagccctggtgttcctgcaggagctaagaaaaaaagaaagattaagaat
ggcagtagccctgaggcaaccacttctggtggttgtccctcgcctaaggatattcaggac
attctgaaggtgctggtgtccgaccttaaccgctccaatggggtagcgatccccccattg
gacaaatggaaggcgcccaaagaccacgctgctcctgtttcaccatctgctgatgacacc
atgtcacctggcggtgtcacttcccccagtgctagtcccccccgtgtcactagcatggca
tcaactcagaaccatgatgttgaaaatggtcctcttaccatggatgaaagcacatctttc
tcatccaccgagagcctgcgacaactatctcagcagctcaacgggcttgtatctgagtct
acatcttacatcaatggggagggcctatcatctcataatataaaggaactggagagccgg
taccaagaactatcagtagccttggactccagcaatctaaaaaacaaacaactcagtagc
aagatagaggaattgaaacaagagaaccaagaggctttggatcaacttgaaaaggagaag
aagggatttgagcaaaagcttgcgaaggaacaaggggctctaagagaacagctgcaggtc
cacattcaaactattgggattctagtgtctgagaagtcagaattacagtcagctctggct
cacacccaacaggcagccagacaaaaagcaggagagtcggaggatctcgctaaccgcctg
cagtcttccaggcagcgcgtgggagagctggagcggacgctctctgccatctccgcgcag
caaaagcaggccgacaggagcaacaaagaattaaccaaggagcgagatgccctcaagctg
gagttatacaagcacaacaaaaacaatgaggacctgaagcagcagaacttggagctggag
gagaagctgcgggtcatggtgagcgagaaggcggccatacagctggggacagatgagctg
cagaagaagctggagatgtcggagctgctgctgcagcagttttctaatcaacctacgcat
ggtagcagcgagcagttacagcaggccctggaagaccgggcacagctggagacccacgtg
cagctgctgaaagattcactgcagcagctgaagatggagagagacctgtacgtggcaaat
atgaaagaagaaaacgccatctggcagcagaagatggaacaaatgtcagagcaggtgtgc
aagttgagggaagaaaaggagcacagcatgagtcaggtgcaggagctggaggccagcttg
gctgaactgaggagccagatggctgcgtgcccaccccaggagtccccagaagggccctcg
gaagcagaacaactgcttcaagaggaggccgagcagctacataaggagctggagagcctg
gcagggcagctgaaggaacaggtgaaagacaatgaaagtctaagtcgcctgaatcaggag
caagagcagcggctgctggagctggagcgggcagctgaggagtggggggaccaggcggag
gagcgcaagcagattctggagagcatgcagaatgaccgcaccaccatcagccgcgcgctc
tcccagaaccgcgagctcaaggagcagctggccgagctgcagaatggatttgtcaggctg
accaatgagaatatggagattacctgcgcgctgcagtcagagcagcacgtcaagaaggag
ctggccaagaagctgagtcagctacaggagaagttggcggaactgaaggagaaggtggag
gcaaagaaccaggaggctcaggggctggaacagcagagggaccagtacctgaaccacctg
cagcagtacgtggctgcctaccagcagcacgtggccgcctaccagcagctggcctctgag
aaggagctgctgcacaagcaggtgctgctgcagacccagctcatggaccggctgcagcac
gaggaggtacaagacaagatggcgatggagatggcccaccaggcattgcaggagacccag
gggctcctggaagctgccaaccaggagaaccagcagctacaggcccagctgaaaatcata
gctgcacccggggaaggagatggaccagacagcgaggagcaggatgaggaggctccccgg
ccaaaactgagcatgccggaggacctggagagccgagaggccatggtggcattctgtaac
tcggccttagccagtgctgaagaagagaaggcgcggcttcgtgagcagctgaaggagcag
aagcttcgctgccagcgcctggctcacctagccaacccatcccaggatggagtggagaag
gaggcccaagcccccgggaccagggagggcagtgtgcctgcagaaacccaccaggccctc
caggaggccatggacaagctgcagggccaatttacaaagattatgcaggagaaagtggat
ctgaaggagcgggtcgaggagctagaacatcgctgcatccagctctcgggagagacagac
actattggagagtacattgctctttatcagaatcagagggcagtgctgcaggagcggcac
cggaagaaggaggagtacattagccggctggctcaggacaaggaggagatgaaggtgaag
ctgctggagctccaggaactggtgtcacgcttgatgggtgagcgtaatgaatgttacggc
aagttcctggctgcccagaaccctgctggggagcccactacagcaccttcagccccccag
gagcttggcactactgacaaccagggtggtctccgggaggtgagccttgtggacaacatg
gagcccacccaagggcaggccctggtgggccagactgctcctgagaacctcactgcacag
cagatcatgcagctgctgcgtgagatccagaacccacgggagtacccaggcttgggcagc
aattcctgcattcctttcttctaccgggcggacgagaatgaccaggtgaagatcaccgtg
gtctaa

DBGET integrated database retrieval system