KEGG   Camelus ferus (Wild Bactrian camel): 102509767
Entry
102509767         CDS       T02979                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04657  IL-17 signaling pathway
cfr04668  TNF signaling pathway
cfr04670  Leukocyte transendothelial migration
cfr04915  Estrogen signaling pathway
cfr04926  Relaxin signaling pathway
cfr05161  Hepatitis B
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05215  Prostate cancer
cfr05219  Bladder cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102509767 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    102509767 (MMP9)
   04670 Leukocyte transendothelial migration
    102509767 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102509767 (MMP9)
   04926 Relaxin signaling pathway
    102509767 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102509767 (MMP9)
   05202 Transcriptional misregulation in cancer
    102509767 (MMP9)
   05206 MicroRNAs in cancer
    102509767 (MMP9)
   05205 Proteoglycans in cancer
    102509767 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    102509767 (MMP9)
   05215 Prostate cancer
    102509767 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102509767 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102509767 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102509767 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfr01002]
    102509767 (MMP9)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     102509767 (MMP9)
Peptidases and inhibitors [BR:cfr01002]
 Metallo peptidases
  Family M10
   102509767 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 Reprolysin_3 DUF4953 Peptidase_M66
Other DBs
NCBI-GeneID: 102509767
NCBI-ProteinID: XP_006187699
LinkDB
Position
19
AA seq 709 aa
MSPWQTLVLVLLVLRCCSAAPRPRQPTFVVFPGDRQTNLTDRQLAEEYLYRYGYTHVAEM
NEDEDSLRRALQRLQRRLALPETGELDTTTLNAIRAPRCGVPDVGKFLTFEGDLKWHHQN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYGREADIVIQFGVREHGDGYP
FDGKDGLLAHAFPPGGGIQGDAHFDDEELWSLGKGVVVPTYFGNANGTACHFPFTFEGRS
YSACTTDGRSDDMLWCSTTANYDTDRKFGFCPSERLHTRDGNADGKPCVFPFTFEGRSYS
ACTTDGRSDGYRWCATTANYDQDKLYGFCPTRADSTVTGGNSAGELCVFPFTFLGKEYST
CTREGRNDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHSLGLDHSSVPEALMY
PMYSYTEENPLHEDDVRGIQYLYGSRPKPEPRPPTTTTAEPQPTAPPTVCVTGPPTTRPS
EGPTAGPTGPPSAGPTGPPTAGPSAAPTAPLDPAEDVCKVEIFDAIAEIGNRLHFFKDGR
YWRLSERGGRRVQGPFLIKNTWPALPRKLDSAFEEPLTKKIFFFSGRKVWVYTGESVLGP
RRLDKLGLGPEVPQVTGALPRAEGKVLLFSRQNFWRFDVKTQKVDPRSATPVDQMFSGVP
LNTHDIFQYQEKAYFCQDRFYWRVSSRNEVNQVDYVGYVSFDLLQCPED
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgagcccctggcagaccttggttctggtgctcctggtgctgcgctgctgctctgccgcc
cccagaccacgccagcccacctttgtggtcttcccaggagaccggcaaaccaatctcacc
gacaggcagctggcagaggaatatctataccgctatggctacactcacgtggcagaaatg
aacgaggacgaggactccttgcgacgggcactgcaacgtctccagcggcgcctggccctg
ccagagactggcgaactggacaccaccaccctgaatgccattcgtgccccgcgctgtggc
gtcccagacgtgggcaaatttctgacctttgagggtgacctcaagtggcaccaccaaaac
atcacctactggatccaaaactactcggaagacttgccgcgcgatgtgatcgacgacgcc
tttgcccgtgccttcgcgctctggagcgccgtgacgccgctcacctttactcgcgtgtac
ggccgcgaagccgacatcgtcatccagtttggtgttagggaacacggagatgggtatccc
ttcgatggtaaggacgggctcctggcacacgcctttcctcctggagggggcattcaggga
gacgcccacttcgatgatgaagagttgtggtccctgggcaagggcgtcgtggttccgacc
tacttcggaaacgcaaatggcaccgcctgccacttccccttcaccttcgaaggccgctcc
tactcggcctgcactacggacggccgctccgacgacatgctctggtgcagcaccacggcc
aactatgacacagaccgcaagttcggtttctgccccagcgagagactccacaccagggac
ggcaatgccgacggcaagccctgcgtgtttccgttcactttcgagggccgctcctactct
gcctgcaccaccgacggtcgctcggacggctaccgctggtgcgccaccaccgccaactac
gatcaggacaagctctatggcttctgtcctacccgagccgactcgacggtgactgggggc
aactcggcgggagagctgtgcgtcttccccttcaccttcctgggcaaggagtactcgacc
tgcaccagagagggccgcaatgatgggcacctctggtgtgccaccacctcgaacttcgac
agagacaagaagtggggcttctgcccagaccaaggatacagcctgttccttgtggctgca
cacgagttcggccactctctgggcttagatcactcgtctgtgccagaggcgctcatgtac
cccatgtacagctacactgaggagaaccccctgcatgaggacgatgtgaggggcatccag
tatctgtatggttctcgccctaaacctgaaccacggcctccaaccaccaccacagctgaa
ccccagcccacggctcccccgacggtctgcgtcaccgggcctcccactacccgcccctca
gagggccccactgctggccccacaggccccccttcagctggtcccacaggtccccccact
gctggcccttctgcggcccctacagcgcccttggatccagcagaggatgtctgcaaagtg
gagatcttcgatgccatcgccgagatcggcaatcgtctgcatttcttcaaggacgggagg
tactggagactctctgagcgcgggggacgccgggtgcagggccccttccttatcaagaac
acgtggcctgcgctgccccgaaagctagactctgcctttgaggagccactcaccaagaag
attttcttcttctctgggcgcaaagtgtgggtgtacacaggcgagtcggtgctaggcccg
aggcgtctggacaagctaggcttgggaccggaggtgccccaggtcaccggggccctcccg
cgcgccgagggtaaggtgttgctgttcagcaggcagaacttctggaggttcgatgtgaag
acgcagaaagtggatccccggagcgccacccccgtagaccagatgttctccggggtgccc
ttgaacactcacgacatcttccagtaccaagagaaagcttacttctgccaggaccgcttc
tactggcgtgtgagttcccggaatgaggtgaaccaggtggactatgtgggctacgtgtcc
tttgatcttctgcagtgccccgaggactag

KEGG   Camelus ferus (Wild Bactrian camel): 102521167
Entry
102521167         CDS       T02979                                 

Gene name
MMP2
Definition
(RefSeq) 72 kDa type IV collagenase isoform X1
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04670  Leukocyte transendothelial migration
cfr04912  GnRH signaling pathway
cfr04915  Estrogen signaling pathway
cfr04926  Relaxin signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05219  Bladder cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102521167 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102521167 (MMP2)
   04915 Estrogen signaling pathway
    102521167 (MMP2)
   04926 Relaxin signaling pathway
    102521167 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102521167 (MMP2)
   05205 Proteoglycans in cancer
    102521167 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    102521167 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102521167 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102521167 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102521167 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfr01002]
    102521167 (MMP2)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     102521167 (MMP2)
Peptidases and inhibitors [BR:cfr01002]
 Metallo peptidases
  Family M10
   102521167 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_5 Reprolysin_3 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 102521167
NCBI-ProteinID: XP_032342226
LinkDB
Position
9
AA seq 661 aa
MTKARVARGALASPLRALCVLGCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQNTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQVTYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLF
NGKEYTSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNK
HESCTSAGRSDGKLWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTYTKNFRLSHDDIKGIQDLYGASPDIDVGTGPTPTLGPITPEICKQDIVFDGIS
QIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSVKSDWLG
C
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaccaaggcgcgagtggcccggggcgcgctcgccagtcctctgcgggcgctctgcgtc
ctgggctgcctgttgggccgcgccgccgccgcgccgtcgcccatcatcaagttccctgga
gatgtcgcccccaaaacggacaaagagttggctgtgcaatacctgaacaccttctacggc
tgccccaaagagagttgtaacctgtttgtgctgaaggacacactgaagaagatgcagaag
ttcttcgggctgccccagacaggcgagctcgaccagaacaccatcgagaccatgcggaag
ccgcgctgtggcaaccccgatgtggccaactacaacttcttcccccgcaagcccaagtgg
gacaagaaccaagtcacttacaggatcattggctacacccctgatctggaccctgagaca
gtggatgatgccttcgctcgtgccttccaagtttggagtgatgtgaccccactgcggttt
tctcggatccatgatggagaggctgacatcatgatcaactttggccgctgggagcatgga
gatggatacccctttgatggcaaagatgggctcctggctcacgccttcgcccccggccct
ggcgttgggggagactcccactttgatgacgatgagctgtggaccctgggggaagggcaa
gtggtccgcgtgaagtatgggaatgccgacggggagtactgcaagttccccttcctgttc
aatggcaaggagtacaccagctgcacggacacgggccgcagcgacggcttcctctggtgc
tccaccacctacaactttgacaaggatggcaagtacggcttctgcccccatgaagccttg
ttcactatgggtggcaacgccgacggtcagccctgcaagttcccattccgcttccagggc
acatcctatgacagctgtaccacggagggccgtaccgacggctaccgctggtgcggtacc
actgaggactacgaccgcgacaagaagtacggcttctgccctgagactgccatgtccact
gtcggcggaaactcggaaggtgccccctgtgtcttccccttcactttcctgggcaacaag
catgagagctgcaccagcgctggccgcagcgacgggaagctgtggtgcgcaaccacggcc
aactacgacgatgaccgcaagtggggcttctgccctgaccaagggtacagcctgttcctg
gtggcagcccatgaatttggccacgcgatggggctggaacactcacaggatcccggagcc
ctgatggcacccatttatacctacaccaagaacttccgcctgtcccacgatgacatcaag
ggcattcaagatctctatggggcttcccccgacattgatgttggcactggccccaccccc
acactgggccccatcactccagagatctgcaaacaggacattgtctttgatggcatctct
cagatccgtggggagatcttcttcttcaaggaccggttcatttggcggacagtgacgcca
cgtgacaagcccatgggacccctgctggtggccacattctggcctgagctcccggaaaag
atcgatgctgtgtacgaggccccacaggaggagaaggctgtgttctttgcagggaatgaa
tactgggtctattcagccagcaccctggagcgagggtaccccaagccgctgaccagcctg
gggcttccccctgatgtccaaaaagtggatgctgcctttaactggagcaagaacaagaag
acgtacatcttcgctggagacaagttctggagatacaatgaggtgaagaagaaaatggat
cctggcttccccaagctcattgcagacgcctggaacgccatccctgataacctcgatgcc
gtggtggacctgcagggtggtggtcacagctacttcttcaagggcgcatattacctgaag
ctggagaaccaaagtctgaagagcgtgaagttcggaagcgtcaaatccgactggctaggc
tgctga

DBGET integrated database retrieval system