KEGG   Camelus ferus (Wild Bactrian camel): 102510030Help
Entry
102510030         CDS       T02979                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00052  Galactose metabolism
cfr00500  Starch and sucrose metabolism
cfr01100  Metabolic pathways
cfr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102510030 (GAA)
   00500 Starch and sucrose metabolism
    102510030 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102510030 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102510030 (GAA)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102510030 (GAA)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102510030 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102510030
NCBI-ProteinID: XP_014406440
LinkDB All DBs
Position
Un
AA seq 945 aa AA seqDB search
MRWPSCSHTLQGVCALASLVLLGHILLYSFAVAPRELCSFSRAPEEMYQARQLGASGLGP
RPAPGHQGSPRAAPTRCDLPPAGRFDCAPDKAITREQCEARGCCYVPARQRPPGAQMGQP
WCFFPSGYPSYKLENLTTTETGYTATLTRTTPTFFPKDIMTLRLDVLMETESRLQIKDPA
NRRYEVPLETPRVHSRAPSTLYSVAFSEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQ
LSTSLPSQHITGLAEHLGPLMLSTNWTKVTLWNRDIAPVPDVNLYGSHPFYLVLEDDGSA
HGVFLLNSNAMDVVLQPSPALSWRSTGGILDLYVFLGPEPKNAVQQYLDIVGHPFMPPYW
GLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDVDYMDARRDFTFNKDGFGDFPAM
VQELHQGGRRYMLIVDPAISSSSPAGTYRPYDEGLRRGGFITNETVRSPVGQVWPGLTAF
PDFTNPEALGWWQDMVGEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPNSDLENPPYVPGV
VGGTLRAATICASSQQFLSTHYNLHNLYGLTEAFASHRALVKARGRRPFVISRSTFAGHG
RFAGHWTGDVWSSWEQLSYSVSAILLFNLVGVPLVGADVCGFLGNTSEELCVRWTQLGAF
YPFMRNHNDLSSLPQEPYRFSETAQQAMRKALGLRYALLPHLYTLFHGAHVRGETVARPL
FLEFPRDPRTWTVDHQLLWGEALLITPVLEAGKVEVTGYFPRGTWYDLQMVPAQAFGSHP
LPPAAPLTSIIHSEGQWVMLPAPLDTINLHVRAGHIIPMQGPGLTTTESRKQPMALAVAL
TPSGEARGELFWDDGESLGVLERGAYTQVIFLAGNNTVVNQLVRVSSEGASLQLRKVIVL
GVAMAPQQVLCNGVPVSNFTYSPDTETLDIPVSLMMGKQFLISWS
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggccgtcctgctcccacaccctgcagggggtctgcgcccttgcctccttggtc
ctcctggggcacatcctgctgtacagcttcgcagtggccccccgagagctgtgcagcttc
tcccgagcacccgaggagatgtaccaagctcgccagctgggagccagtggcctagggccc
cggcccgccccagggcaccaaggcagccccagggcagcgcccacacggtgtgacctgccc
cccgctggccgcttcgactgtgccccagacaaggccatcacccgggagcagtgcgaggcc
cggggctgctgctacgtgcccgcgaggcagcggcctcccggggcccagatggggcagccc
tggtgcttcttcccttccggctaccccagttacaagctggagaacctgaccaccacggag
acgggctacacagccaccctgacgcgcaccaccccgaccttcttccccaaggacatcatg
accttacggctggatgtgctgatggagacggagagccggctccagatcaaagatcccgcc
aacaggcgctacgaagtgcccttggagaccccgcgtgtccacagccgggcgccgtccacg
ctctacagtgtggcgttctcggaggagccctttggggtggtcgtgcggcggaagctggat
ggacgggtgctgctgaacaccaccgtggctcccctgttctttgccgaccagtttctgcag
ctgtccacctccctgccatcccagcacatcacaggccttgccgaacacctcgggcccctg
atgctcagcaccaactggaccaaggtcaccctctggaatcgggacatcgcccccgtgcct
gatgtgaacctgtacgggtcccaccctttctacctggtgctggaggacgacgggtcagct
cacggggtcttcctgctgaacagcaatgccatggacgtggtcctgcagccaagcccagcc
ctcagctggaggtcgacaggcgggattctggacttgtacgtcttcctgggcccggagccc
aagaacgcagtgcagcagtacctggacatcgtgggccacccgttcatgccgccgtactgg
ggcctgggcttccacctgtgtcgctggggctactcctccaccgccatcacccgccaggtt
gtggagaacatgaccagggcccatttccccctggacgtccagtggaacgacgtggactac
atggacgccaggagggacttcactttcaacaaggacggcttcggggacttcccggccatg
gtgcaggagctccaccagggcggccggcggtacatgctgatcgtcgatcctgccatcagc
agctccagccccgccgggacctaccgcccctacgacgagggcctgcggcgggggggcttc
atcaccaacgagaccgtcagatcccccgtaggccaggtgtggcccggactcaccgccttc
cccgacttcaccaaccccgaggccctaggctggtggcaggacatggtgggcgagttccac
gcccaggtgcccttcgatggcatgtggattgacatgaacgagccatccaacttcgtgagg
ggctctgtggacggctgccccaacagtgacctggagaacccgccctacgtgccaggggtg
gtcggcgggaccctccgggcagccaccatctgcgcctccagccagcagttcctctccacg
cactacaacctgcacaacctgtatggcctgaccgaggccttcgcctcccacagagccctg
gtgaaggctcgggggaggcggcccttcgtgatctctcgctcaacctttgctggccacggc
cgattcgctggccactggacaggggacgtgtggagcagctgggagcagctctcctactcc
gtgtcagccatcctgcttttcaatctggtgggggtgcccctggtgggggcggacgtctgc
ggcttcctgggcaacacctcggaggagctgtgcgtgcgctggacccagctgggggccttc
taccccttcatgcggaaccacaacgacctcagcagcctgccgcaggagccgtacaggttc
agcgagacggcgcagcaagccatgaggaaggccttgggcctgcgctacgcgctcctgccc
cacctctacacgctgttccacggggcccacgtcaggggcgagaccgtggctcggcccctc
ttcctggagttccccagagacccccgcacctggaccgtggaccaccagctcctgtggggg
gaggctctgctcatcactccagtcctcgaggccgggaaggttgaggtcactggctacttc
ccccgaggcacgtggtatgacctgcagatggtgccagctcaggcctttggcagccatcca
cttccgcccgctgcacccctaacatccatcatccacagtgaggggcagtgggtgatgcta
cccgccccactggacaccatcaacctccacgtccgggccggtcacatcatccccatgcag
ggcccaggcctcacaaccacagagtcccgcaaacagcccatggccttggccgtggcactg
accccgagcggggaggcccgaggggagctgttctgggacgacggggagagcctgggggtg
ctggagcgcggggcttacacgcaggtcatctttctggctggaaacaacactgtcgtgaac
cagttggtgcgtgtgagcagcgagggggccagcctgcagctgaggaaggtgatcgtcctt
ggggtggccatggccccccagcaggtcctctgcaacggcgttcctgtctctaacttcacc
tacagccctgacactgagaccctggacatccctgtctcactgatgatgggaaagcagttt
ctcatcagttggtcttaa

DBGET integrated database retrieval system