KEGG   Camelus ferus (Wild Bactrian camel): 102510168
Entry
102510168         CDS       T02979                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04012  ErbB signaling pathway
cfr04912  GnRH signaling pathway
cfr04915  Estrogen signaling pathway
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr05171  Coronavirus disease - COVID-19
cfr05205  Proteoglycans in cancer
cfr05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102510168 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102510168 (HBEGF)
   04915 Estrogen signaling pathway
    102510168 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    102510168 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102510168 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    102510168 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102510168 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102510168 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfr00536]
    102510168 (HBEGF)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102510168 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 102510168
NCBI-ProteinID: XP_032332824
LinkDB
Position
3
AA seq 208 aa
MKLPPSVVLKLILAAVLSALVTGDSLERLRRGLAAGTSNLDSPTESTDQLLPPGGGRGRE
ALDLEEGNMDLFRAAFSSKPQALATPGKEERGKRKKKGKGLGKKRDPCLRKYKDYCIHGD
CKYLKEFRAPSCICHPGYHGERCHGLSLPVKNRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTTSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgccgccgtcggtggtgctgaagctcattctggctgcagtgctctcggcgttg
gtgaccggcgacagcctggagcggcttcggagagggcttgcggctggaaccagcaatctg
gactctcccactgaatctacggaccagctgttgcccccgggaggtggccgaggccgggaa
gccctggacttggaagagggaaacatggaccttttcagagctgctttctcctctaagccg
caagctctggccacaccgggcaaggaggagcgtgggaaaagaaagaagaaaggcaagggg
ttagggaagaagagagacccgtgtcttcggaaatacaaggattactgcatccacggagac
tgcaaatatttgaaggagttccgggctccatcctgcatctgccacccaggttaccatgga
gaaaggtgccatggactgagcctcccagtgaaaaatcgtttatatacctatgatcacaca
accatcctggctgtggtggccgtggtgctgtcatccgtctgtctgctcgtcattgtgggg
cttctcatgtttaggtaccacaggagaggaggttatgatgtggaaaatgaagagaaagtg
aaattgggcatgactacttcccactga

DBGET integrated database retrieval system