KEGG   Camelus ferus (Wild Bactrian camel): 102510977Help
Entry
102510977         CDS       T02979                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00010  Glycolysis / Gluconeogenesis
cfr00053  Ascorbate and aldarate metabolism
cfr00071  Fatty acid degradation
cfr00280  Valine, leucine and isoleucine degradation
cfr00310  Lysine degradation
cfr00330  Arginine and proline metabolism
cfr00340  Histidine metabolism
cfr00380  Tryptophan metabolism
cfr00410  beta-Alanine metabolism
cfr00561  Glycerolipid metabolism
cfr00620  Pyruvate metabolism
cfr01100  Metabolic pathways
Module
cfr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102510977 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102510977 (ALDH2)
   00620 Pyruvate metabolism
    102510977 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102510977 (ALDH2)
   00561 Glycerolipid metabolism
    102510977 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102510977 (ALDH2)
   00310 Lysine degradation
    102510977 (ALDH2)
   00330 Arginine and proline metabolism
    102510977 (ALDH2)
   00340 Histidine metabolism
    102510977 (ALDH2)
   00380 Tryptophan metabolism
    102510977 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102510977 (ALDH2)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102510977 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 102510977
NCBI-ProteinID: XP_006178147
LinkDB All DBs
Position
Un
AA seq 422 aa AA seqDB search
MDASNRGRLLNRLADLIERDRSYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADK
YHGKTLPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LTALYVASLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAG
NSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYTEF
VERSVARARSRVVGNPFDSQTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRG
YFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDK
ANYLSQALQAGTVWVNCYDVFGAQSPFGGYKLSGNGRELGEYGLQAYTEVKTVTVKVPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgtccaacaggggccggctgctgaaccgcctggccgatctgattgagcgggac
cggagctacctggcagccttggagaccctggacaatggcaagccctatgtcatctcctac
ctggtggatttggacatggtcctcaaatgtctccgttactacgctggctgggctgataag
taccatgggaaaacccttcccattgatggggactacttcagctacacccgccacgaacct
gtgggggtatgcgggcagattatcccgtggaacttcccgctcttgatgcaagcatggaag
ctgggcccagccttggcgactggaaacgtggttgtgatgaaggtggctgaacagactcca
ctcactgccctctatgtggccagcctgatcaaggaggctggctttcctcctggtgtggtc
aacattgttcctggatttggccccacagccggggccgccattgcctcgcatgaggatgtg
gacaaagtggccttcacaggctccactgaggttggccacctaatccaggttgctgcaggg
aacagtaacctcaagagagtgaccctggagctaggaggaaagagccctaacatcatcatg
tcagatgctgacatggactgggccgtggagcaggcccacttcgccctgttcttcaaccag
ggccagtgctgttgtgcgggctcccggacctttgtgcaggaggacatttacaccgagttt
gtggagcggagtgttgcccgggccaggtctcgtgtggttgggaacccctttgacagccag
actgagcaggggcctcaggtggatgaaacccagtttaagaaggtccttggctatatcaaa
tctgggaaggaggagggggcaaagctgctgtgtggtggaggggcggctgctgaccgtggc
tacttcatccagcccaccgtgtttggagacgtgcaagatggcatgaccattgcaaaagag
gagatcttcgggccagtgatgcagatcctgaagttcaagaccatagaggaagttgttggg
agagctaacaattccaagtatgggctggccgcagctgtcttcacaaaggacttggacaag
gccaattatttgtcccaagccctccaggctggcactgtgtgggtcaactgctatgatgtg
tttggggcccagtccccgtttggtggctacaagctgtctgggaatggccgggagctggga
gagtatgggctgcaggcgtacactgaagtgaaaaccgtcacagtcaaagttcctcagaag
aactcataa

DBGET integrated database retrieval system