KEGG   Camelus ferus (Wild Bactrian camel): 102511001
Entry
102511001         CDS       T02979                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04012  ErbB signaling pathway
cfr04062  Chemokine signaling pathway
cfr04217  Necroptosis
cfr04630  JAK-STAT signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04917  Prolactin signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr05161  Hepatitis B
cfr05162  Measles
cfr05166  Human T-cell leukemia virus 1 infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102511001 (STAT5B)
   04630 JAK-STAT signaling pathway
    102511001 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102511001 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102511001 (STAT5B)
   04659 Th17 cell differentiation
    102511001 (STAT5B)
   04062 Chemokine signaling pathway
    102511001 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102511001 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    102511001 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102511001 (STAT5B)
   05203 Viral carcinogenesis
    102511001 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102511001 (STAT5B)
   05220 Chronic myeloid leukemia
    102511001 (STAT5B)
   05223 Non-small cell lung cancer
    102511001 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102511001 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102511001 (STAT5B)
   05161 Hepatitis B
    102511001 (STAT5B)
   05162 Measles
    102511001 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102511001 (STAT5B)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102511001 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 102511001
NCBI-ProteinID: XP_032313107
LinkDB
Position
16
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPAGSLADTMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVTLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASADSAG
GSATYMDQAPSPAVCPQAHYNIYPQNPDPVLDNDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggagatgcccttcatcaaatgcaagct
ttgtatggtcagcatttccccatcgaagtgcggcattatttatctcagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactacgccacgcagctccagaacacctatgaccgc
tgccccatggagcttgtccgctgcatccgccacatcctgtacaatgaacagaggctggtc
cgagaagccaacaatggtacttctccggctggaagtctcgctgataccatgtcccagaaa
caccttcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacagagaat
gagttgaagaagctgcagcagactcaagagtacttcatcatccaatatcaagagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccgcaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgaccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggatgacgaactgatccagtggaagcggcggcagcag
ctggccgggaacggagggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagattcgcagagctgagcacctgtgc
cagcagctgcccatccccggcccagtggaggagatgctggctgaggtcaacgccaccatc
acggacatcatctcagccctggtgaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagccactgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgattacagcggagagatcttgaacaactgc
tgtgtgatggagtaccaccaggccacaggcaccctcagcgcccacttcaggaacatgtcc
ctgaaacggattaaaaggtctgaccgtcgtggagcagagtcagtgacagaagaaaaattt
acaatcctatttgaatcacagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctcccggtggtggtgattgttcacggcagccaggacaacaacgcgacggcc
accgtcctctgggacaatgcttttgcagagcctggcagggtgccgttcgcggtgcccgac
aaagtcctgtggccgcagctgtgcgaggcactcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctgttcaacagc
agtagcagccacctcgaggactacaacggcatgtccgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacaccttctggcagtggtttgatggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggctattttgggtttcgtgaacaag
caacaggcccacgacctgctcattaacaagccagatgggaccttcctgctgaggttcagc
gactctgaaattggtggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccatccggtccctggccgaccgcttg
ggggacctaagttaccttatctacgtgtttcctgatcgtccaaaagatgaagtgtactcc
aaatattacaccccagttccctgcgagcctgccactgccaaagcagtggacggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgagcgcctctgcagactctgctggg
ggcagcgctacctacatggaccaggccccgtccccggccgtgtgcccccaggctcattat
aacatttacccacagaacccagaccccgtccttgacaacgatggggacttcgatctggat
gacacgatggatgtggcgcggcgtgtggaggagcttttaggccgacctatggacagtcag
tggatcccgcacgcgcagtcatga

KEGG   Camelus ferus (Wild Bactrian camel): 102520794
Entry
102520794         CDS       T02979                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04012  ErbB signaling pathway
cfr04217  Necroptosis
cfr04630  JAK-STAT signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04917  Prolactin signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04935  Growth hormone synthesis, secretion and action
cfr05161  Hepatitis B
cfr05162  Measles
cfr05166  Human T-cell leukemia virus 1 infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102520794
   04630 JAK-STAT signaling pathway
    102520794
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102520794
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102520794
   04659 Th17 cell differentiation
    102520794
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102520794
   04935 Growth hormone synthesis, secretion and action
    102520794
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102520794
   05203 Viral carcinogenesis
    102520794
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102520794
   05220 Chronic myeloid leukemia
    102520794
   05223 Non-small cell lung cancer
    102520794
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102520794
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102520794
   05161 Hepatitis B
    102520794
   05162 Measles
    102520794
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102520794
Transcription factors [BR:cfr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102520794
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 102520794
NCBI-ProteinID: XP_032313111
LinkDB
Position
16
AA seq 794 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSSAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVTLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLTAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLDYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVSASADSAGGSATY
MDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDHRLS
PPTGLFTSARGSLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ttgtacgggcagcacttccccatcgaagtccggcattacttagcacagtggatagagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgagcgcaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagacggg
ttcttactgaagatcaagctggggcactacgccacgcagctccagaacacgtatgaccgc
tgccccatggagcttgtccgctgtatccgccatattctgtacaatgaacagagactggtc
cgagaagccaacaatggtagttcttctgctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacatttgaggagctgcgactggtcacacaggacacagagaat
gagttgaagaagctgcagcagactcaagagtacttcatcatccaatatcaagagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccgcaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgaccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggatgacgaactgatccagtggaagcggcggcagcag
ctggccgggaacggagggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagattcgcagagctgagcacctgtgc
cagcagctgcccatccccggcccagtggaggagatgctggctgaggtcaacgccaccatc
acggacatcatctcagccctggtgaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagccactgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaacgagtgcagtggagagatcttgaacaactgc
tgtgtgatggagtaccaccaggccacaggcaccctcactgcccacttcaggaacatgtcg
ctaaagaggatcaagcgcgctgaccgacgaggcgcagagtctgtgacagaggagaagttc
acagtcctgtttgagtctcagttcagcgtcggcagcaatgagcttgtgttccaggtgaag
accctgtcccttcctgtggttgtcatcgttcacggcagccaggaccacaatgctaccgcc
acagtgctgtgggacaatgcctttgctgagccaggcagggtgccgttcgcggtgcccgac
aaagtcctgtggccgcagctgtgcgaggcgctcaatatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaaccttgtgttcctggcgcagaagctgttcaacagc
agcagcagccacctcgaggactacaacggcatgtccgtgtcctggtcccagttcaacagg
gagaacttgcccggctggaactataccttctggcagtggtttgatggggtcatggaggtg
ctgaagaaacatcacaagccccattggaatgatggagccatcctaggttttgtgaataag
caacaggcccatgatctgctcatcaacaagcccgatggaaccttcttgttgcgctttagt
gactcagaaatcgggggcatcaccattgcctggaagtttgactctccggaccgtaacctg
tggaatctgaagccattcaccacgagggatttctccatccgatctctggccgaccggctg
ggagacctggactatctcatctacgtgtttccagaccggcccaaggatgaggtcttctcc
aagtactacactcctgtgctcgccaaagcagtggacggatatgtgaagccacagatcaag
caagtggtccctgagtttgtgagcgcctctgcagactctgctgggggcagcgccacctac
atggaccaggccccctctccagctgtgtgcccccaggctcattataacatgtacccacag
aaccctgaccccgtccttgaccaggatggagagttcgacctggatgagaccatggatgta
gcccggcacgtggaggaactcttacgccgcccgatggacagcctggaccaccggctctcc
ccgcctactggtctcttcacctctgccagaggctcgctctcgtga

DBGET integrated database retrieval system