KEGG   Camelus ferus (Wild Bactrian camel): 102511086
Entry
102511086         CDS       T02979                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04110  Cell cycle
cfr04151  PI3K-Akt signaling pathway
cfr04218  Cellular senescence
cfr04310  Wnt signaling pathway
cfr04350  TGF-beta signaling pathway
cfr04390  Hippo signaling pathway
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04630  JAK-STAT signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr05132  Salmonella infection
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05213  Endometrial cancer
cfr05216  Thyroid cancer
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102511086 (MYC)
   04012 ErbB signaling pathway
    102511086 (MYC)
   04310 Wnt signaling pathway
    102511086 (MYC)
   04350 TGF-beta signaling pathway
    102511086 (MYC)
   04390 Hippo signaling pathway
    102511086 (MYC)
   04630 JAK-STAT signaling pathway
    102511086 (MYC)
   04151 PI3K-Akt signaling pathway
    102511086 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102511086 (MYC)
   04218 Cellular senescence
    102511086 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102511086 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102511086 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102511086 (MYC)
   05202 Transcriptional misregulation in cancer
    102511086 (MYC)
   05206 MicroRNAs in cancer
    102511086 (MYC)
   05205 Proteoglycans in cancer
    102511086 (MYC)
   05230 Central carbon metabolism in cancer
    102511086 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102511086 (MYC)
   05225 Hepatocellular carcinoma
    102511086 (MYC)
   05226 Gastric cancer
    102511086 (MYC)
   05216 Thyroid cancer
    102511086 (MYC)
   05221 Acute myeloid leukemia
    102511086 (MYC)
   05220 Chronic myeloid leukemia
    102511086 (MYC)
   05219 Bladder cancer
    102511086 (MYC)
   05213 Endometrial cancer
    102511086 (MYC)
   05224 Breast cancer
    102511086 (MYC)
   05222 Small cell lung cancer
    102511086 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102511086 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102511086 (MYC)
   05161 Hepatitis B
    102511086 (MYC)
   05160 Hepatitis C
    102511086 (MYC)
   05163 Human cytomegalovirus infection
    102511086 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102511086 (MYC)
   05169 Epstein-Barr virus infection
    102511086 (MYC)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    102511086 (MYC)
Messenger RNA biogenesis [BR:cfr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102511086 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 102511086
NCBI-ProteinID: XP_032323529
LinkDB
Position
25
AA seq 438 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGFSTADQLEMVTELLGGDMVNQSFICDPDD
ETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSSSPSPARGHGGCSTSSLYLQDL
SAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLALH
EETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRCH
VSTHQHNYAAPPSTRKDYPAAKRAKLDNGRVLKQISNNRKCASPRSSDTEENDKRRTHNV
LERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEEQKLISEKDVLR
KRREQLKLKLEQLRNSCA
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcccctcaatgtcagcttcaccaacaggaactatgacctcgactatgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtccccaagccgccgctccgggctctgctctccctcctacgttgcggtcgcgtccttc
tcccccaggggagacgacgacggcggcggcggcttttccactgctgaccagttggagatg
gtgaccgagctgctgggaggagatatggtgaaccagagcttcatatgcgacccggacgac
gagaccttcatcaaaaatatcatcatccaggactgtatgtggagcggcttctcggccgcc
gccaagctcgtctccgagaagctggcctcctaccaggctgcgcgcaaagacagcagcagc
ccgagccccgcccgtgggcacggcgggtgctccacctccagcctgtacctgcaggaccta
agcgccgccgcctccgaatgcatcgacccctccgtggtcttcccctacccgctcaacgac
agcagttcgcccaagccctgcgcctccccggactccaccgccttctccccgtcctcggac
tctctgctctcctccgccgagtcgtccccgcgggccagtcccgagcccctggcgctccac
gaggagacaccacccaccaccagcagcgactctgaggaagaacaagaggatgaggaagaa
attgatgttgtttctgtagagaagaggcagccccctgccaaaaggtcggaatcggggtca
ccttctgccggaggccacagcaaacctcctcacagcccattggtccttaagagatgccat
gtgtccacccatcagcacaattatgcagcgccaccctccaccaggaaggactatcctgct
gccaagagggctaagttggacaatggcagggtcctgaaacagatcagcaacaacagaaaa
tgtgccagccccaggtcttcggacacggaggagaatgacaagaggcggacacacaacgtc
ttggagcgccagaggaggaacgagctgaaacgcagcttttttgcccttcgtgaccagatc
ccggagttggagaacaatgaaaaagcccccaaggtagttatccttaaaaaagccacagcc
tacatcttgtccatccaagcagaggagcaaaagctcatttcagaaaaagacgtgttgcgg
aagaggcgagaacagttgaaactcaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system