KEGG   Camelus ferus (Wild Bactrian camel): 102511221Help
Entry
102511221         CDS       T02979                                 

Gene name
HK3
Definition
(RefSeq) hexokinase 3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00010  Glycolysis / Gluconeogenesis
cfr00051  Fructose and mannose metabolism
cfr00052  Galactose metabolism
cfr00500  Starch and sucrose metabolism
cfr00520  Amino sugar and nucleotide sugar metabolism
cfr00524  Neomycin, kanamycin and gentamicin biosynthesis
cfr01100  Metabolic pathways
cfr01200  Carbon metabolism
cfr04066  HIF-1 signaling pathway
cfr04910  Insulin signaling pathway
cfr04930  Type II diabetes mellitus
cfr04973  Carbohydrate digestion and absorption
cfr05230  Central carbon metabolism in cancer
Module
cfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cfr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102511221 (HK3)
   00051 Fructose and mannose metabolism
    102511221 (HK3)
   00052 Galactose metabolism
    102511221 (HK3)
   00500 Starch and sucrose metabolism
    102511221 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    102511221 (HK3)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102511221 (HK3)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    102511221 (HK3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102511221 (HK3)
  Digestive system
   04973 Carbohydrate digestion and absorption
    102511221 (HK3)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102511221 (HK3)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102511221 (HK3)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102511221 (HK3)
Membrane trafficking [BR:cfr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102511221 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102511221
NCBI-ProteinID: XP_014414048
LinkDB All DBs
Position
Un
AA seq 924 aa AA seqDB search
MDSVGPLGLQQGDGAPGCPQEALPCPSNSPELVQECLRQFKVTGAQLRQIQASLLGSMEQ
ALSGQANPAPTVRMLPTYVGSVPHGTEQGDFVVLELGAIGASLRVLWVTLMGTKGHRMEP
QSREFVIPQEVMVGPGQQLFDFAARCLSEFLDAFPVGNQGLQLGFSFSFPCHQTGLDKST
LISWTKGFRCSGVEGQDVVQLLRDAIQRQGAYSIDVVAVVNDAVGTMMGCEPGAGPCEVG
LVVDTGTNACYMEEARHVAVLDEDRGRVCISVEWGSFSDDGALGPVLTTFDHALDHESLN
PGAQRFEKMIGGLYLGELVRLVLAHLAQRGVLFGGCTSPALLSRGGILLEHVAEMEDPSA
GAARVHTILQDLGLRPRASDTELVRHVCVAVCTRAAQLCAAALAAVLSRLQRSREQETLQ
IAVATGGRVFERHPRFLSILQETVMLLAPKCDVSFIPSVDGGGRGVAMVTAVAARLAAHR
RLLEETLAPFRLTREQLAAVQAQMREAMARGLRGEASSLRMLPTYVRATPDGSERGDFLA
LDLGGTNFRVLLVRVATGGVQISSQIYSIPECVAQGSGQQLFDHIVDCIVDFQQKQGLSG
QSLPLGFTFSFPCRQLGLDQGILLTWTKGFNASDCEGQDVVCLLREAIRRRQATELNVVA
IVNDTVGTMMSCGYEDPRCEVGLIVGTGTNACYMEELRNVASVAGDSGHMCINMEWGAFG
DDGSLGMLSTNFDASVDQASINPGKQRFEKMISGMYLGEIVRHVLLHLTSLGVLFRGQPT
QRLQTRDIFKTKFLSEIESDSLALRQVRAILEALGLPLTSDDALMVLEVCQAVSQRAAQL
CGAGVAAVVEKIRENRGLEELTVSVGVDGTLYKMHPHFSSLVAATVRELAPRCAVTFLQS
EDGSGKGAALVTAVACRLAQMTHV
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggactccgtggggcctctagggttgcagcaaggggatggagctcccggctgcccccag
gaagccttgccctgcccctcaaacagccctgagctggtgcaggagtgcctgcggcagttc
aaggtgacaggggcacagctgcggcagatccaagccagcctcctgggctccatggagcag
gcgctgagcgggcaggccaaccctgcccctactgtccggatgctgcccacatatgtgggg
tctgtcccgcatggcactgagcaaggagacttcgtggtgctggagctgggggccatagga
gcctcactgcgtgttctatgggtgaccctgatgggcactaaagggcacaggatggagccc
cagagccgggagtttgtgatcccccaagaggtgatggtgggtcctggtcagcagcttttt
gactttgccgcccgctgcctgtctgagttcctggatgcgttccctgtgggcaatcagggt
ctgcagcttgggttcagcttctccttcccttgtcaccagacaggcctggacaagagcaca
ctcatttcctggaccaaaggttttaggtgcagtggtgtggaaggtcaggatgtggtccag
ctgctgcgagatgctatccagaggcagggggcctacagcattgacgtggttgccgtggtg
aatgacgcagtgggcaccatgatgggctgtgagccgggggctgggccctgtgaagtcggg
ctggttgtagacactggcaccaatgcgtgttacatggaggaggcccggcatgtggctgtg
ctggatgaggaccggggccgcgtctgcatcagcgttgagtggggctccttcagtgatgac
ggggccctggggccagtgctgaccacttttgaccacgccctggaccacgagtccctgaat
ccgggtgcccagaggtttgagaagatgattgggggactgtacctgggtgagctggtgcgg
ctggtgctggctcacctggcccagcgcggggtcctcttcggtggctgcacttcccctgct
ctgctaagcagaggtggcatcctcctggaacatgtggctgagatggaggatccctctgct
ggggcagcccgtgtgcacactatcctgcaggacttaggcctgcgtccaagggcctcagat
actgagctcgtgcggcacgtgtgtgtggctgtgtgcacgcgggctgcccagctctgtgca
gctgctctggctgccgtcctctcccgcctccagcgcagccgcgagcaggagacacttcag
attgctgtggccactggaggccgagtgtttgagcgacaccccaggttcctcagcattctg
caggagacagtgatgctcctggcccctaaatgtgatgtctccttcatcccctctgtggat
gggggcggccggggcgtggcaatggtgactgctgtggctgcccgcctggctgcccaccgg
cgcctgctggaggagaccctggccccattccggttgacccgtgagcagctggcagcggtg
caggcacagatgcgagaggccatggccagggggctccgtggagaggcctcctccctccgc
atgctgcccacttacgtccgggccacacctgatggcagcgaacgtggggacttcctggcc
ctggacctggggggcaccaacttccgggtcctcctggtgcgtgtggccacgggaggtgtg
cagatctccagccagatctactctatcccggagtgtgtggcccagggctctggacagcag
ctctttgaccacattgtggactgcatcgtggacttccagcagaagcagggcctaagtggg
cagagtctccccctgggtttcaccttctccttcccatgcaggcagctcggcctggaccag
ggcatcctcctgacctggacaaagggtttcaatgcatccgactgtgagggtcaagacgtc
gtgtgcctgctgcgggaagctatcagacgcagacaggcaacggagctgaatgtggttgcc
attgtcaatgacacggtggggaccatgatgtcctgtggctatgaggacccgcgctgcgaa
gtcggcctcatcgttggaaccggcaccaatgcctgctacatggaggagctccggaatgtg
gcgagcgtggccggggactcaggccacatgtgcatcaacatggagtggggtgcctttggg
gatgatggttctctcggcatgctcagcaccaactttgatgcaagtgtggaccaggcatcc
atcaatcctggcaagcagaggtttgagaagatgatcagcggcatgtacctgggggagatc
gtccgccacgtcctcttgcatttgaccagccttggagttctcttccggggccagccgacc
cagcgccttcagaccagggacatcttcaagaccaagtttctctctgagattgaaagtgac
agcctggccctgaggcaggtccgagccatcctggaggctctggggctgcccttgacctca
gatgatgccctgatggtcctggaggtgtgtcaggccgtgtcccagcgggccgcccagctt
tgtggggcaggtgtggctgccgtggtggagaagatccgtgagaaccggggcctggaagag
ctgaccgtatccgtaggggtggatgggaccctctacaagatgcacccccacttctccagt
ctggtggcagccacggtgcgagagctggctcctcgctgtgcagtcactttcctgcagtcg
gaggatgggtctggcaaaggtgctgccctggtcactgctgttgcctgtcgcctggcccag
atgacccatgtctga

DBGET integrated database retrieval system