KEGG   Camelus ferus (Wild Bactrian camel): 102511249Help
Entry
102511249         CDS       T02979                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00500  Starch and sucrose metabolism
cfr01100  Metabolic pathways
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04910  Insulin signaling pathway
cfr04922  Glucagon signaling pathway
cfr04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102511249 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102511249 (GYS1)
   04152 AMPK signaling pathway
    102511249 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102511249 (GYS1)
   04922 Glucagon signaling pathway
    102511249 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    102511249 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfr01003]
    102511249 (GYS1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102511249 (GYS1)
Glycosyltransferases [BR:cfr01003]
 Polysaccharide
  Storage polysaccharide
   102511249 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102511249
NCBI-ProteinID: XP_006173876
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGSPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDVPPDEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSSGGSKRGSVDTAPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctcactgccaggactggaggattgggaagat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacggtgctgcagacgaaggcgaaggtgacaggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaacttctc
gagcccccgaccccggccctgaagaggacgctggactccatgaacagcaagggttgcaag
gtgtatttcgggcgctggctgatcgaggggagccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggcgagctgtgggacacgtgcaacatcggg
gtgccctggtacgaccgggaggctaacgatgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacatgtggttgcgcacttccat
gagtggttggcgggcgtcgggctctgcctgtgccgtgcccggcggctgcctgtggctaca
atcttcaccacccatgccacgctgctggggcgatacctatgtgccggtgctgtggacttc
tacaataacctggagaatttcaatgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcagcagcccactgcgctcatgtcttcactaccgtgtcccag
attaccgccatcgaggctcagcacctgctcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgaattccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtacttctttattgctggccgctatgagttctccaacaagggggctgat
gtcttcctggaggctttggcccggctcaactatctgctcagagtgaacggcagcgagcag
acagtggtcgccttcttcatcatgccggctcggaccaacaacttcaacgtggaaaccctg
aagggccaagccgtgcgcaagcagctttgggatacagccaacacagtgaaggagaagttt
gggaggaaactttatgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggatttcactatgatgaagagagccatctttgccacacagcggcagtctttt
ccccctgtgtgcacccacaatatgctggatgactcctcggaccctatcttgactaccatc
cgccgaattggcctcttcaatagtagtgccgacagggtcaaggtgatttttcacccagag
ttcctctcctccacaagccccctgctccccgtggactatgaagagtttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacgccagctgagtgcacg
gtcatgggtatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggcatctacatcctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcattatccagcggaaccgcacggagcgcctctctgatcttctggactggaaatac
ctaggccggtactacatgtccgcgcgccacatggcactggccaaggcctttccggaacac
ttcacttacgagccccacgaggctgacgcgacccagggctaccgctacccacggccagcc
tcagtgccaccatcaccctcactgtcacgacactcgagcccgcaccagagcgaggatgag
gaggagcccagggatgtaccacccgatgaagacggtgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaatatccgcgctcctgagtggccgcgccgcgcctcctgcacc
tcttcctctggcgggagcaagcgcggctcggtggacacagcgccctccagctcactgagc
acccccagcgagcccctcagccctgccagttccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system