KEGG   Camelus ferus (Wild Bactrian camel): 102511476
Entry
102511476         CDS       T02979                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04015  Rap1 signaling pathway
cfr04062  Chemokine signaling pathway
cfr04510  Focal adhesion
cfr04666  Fc gamma R-mediated phagocytosis
cfr04722  Neurotrophin signaling pathway
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04935  Growth hormone synthesis, secretion and action
cfr05100  Bacterial invasion of epithelial cells
cfr05135  Yersinia infection
cfr05163  Human cytomegalovirus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05211  Renal cell carcinoma
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102511476 (CRK)
   04012 ErbB signaling pathway
    102511476 (CRK)
   04015 Rap1 signaling pathway
    102511476 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102511476 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102511476 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102511476 (CRK)
   04062 Chemokine signaling pathway
    102511476 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102511476 (CRK)
   04935 Growth hormone synthesis, secretion and action
    102511476 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102511476 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102511476 (CRK)
   05206 MicroRNAs in cancer
    102511476 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102511476 (CRK)
   05211 Renal cell carcinoma
    102511476 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102511476 (CRK)
   05100 Bacterial invasion of epithelial cells
    102511476 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102511476 (CRK)
   05163 Human cytomegalovirus infection
    102511476 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cfr04990]
    102511476 (CRK)
Domain-containing proteins not elsewhere classified [BR:cfr04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   102511476 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 102511476
NCBI-ProteinID: XP_032313388
LinkDB
Position
16
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggctgagccgg
caggaggcggtggcgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacgacgttgatagaaccagtttccaga
tccaggcagggtagtggcgtgattctcaggcaggaggaggcagagtatgtacgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagaggggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcccgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

KEGG   Camelus ferus (Wild Bactrian camel): 102516584
Entry
102516584         CDS       T02979                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04012  ErbB signaling pathway
cfr04015  Rap1 signaling pathway
cfr04062  Chemokine signaling pathway
cfr04510  Focal adhesion
cfr04666  Fc gamma R-mediated phagocytosis
cfr04722  Neurotrophin signaling pathway
cfr04810  Regulation of actin cytoskeleton
cfr04910  Insulin signaling pathway
cfr04935  Growth hormone synthesis, secretion and action
cfr05100  Bacterial invasion of epithelial cells
cfr05135  Yersinia infection
cfr05163  Human cytomegalovirus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05211  Renal cell carcinoma
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102516584 (CRKL)
   04012 ErbB signaling pathway
    102516584 (CRKL)
   04015 Rap1 signaling pathway
    102516584 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102516584 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102516584 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102516584 (CRKL)
   04062 Chemokine signaling pathway
    102516584 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102516584 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    102516584 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102516584 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102516584 (CRKL)
   05206 MicroRNAs in cancer
    102516584 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102516584 (CRKL)
   05211 Renal cell carcinoma
    102516584 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102516584 (CRKL)
   05100 Bacterial invasion of epithelial cells
    102516584 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102516584 (CRKL)
   05163 Human cytomegalovirus infection
    102516584 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cfr04990]
    102516584 (CRKL)
Domain-containing proteins not elsewhere classified [BR:cfr04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   102516584 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 102516584
NCBI-ProteinID: XP_006177117
LinkDB
Position
32
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LMRPSPHGKHGNRNSSSYGIPEPAHAYAQPQTTAPLPAASSSPGATVNPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctccgcctggtacatggggccggtgtct
cgccaggaagcgcagacccggctccagggccagcgccacggcatgttcctggttcgcgac
tcgtccacctgccccggcgactacgtgctgtccgtgtccgagaactcgcgggtgtcccat
tacatcatcaactcgctgcccaaccgtcgcttcaagatcggggatcaggagttcgaccac
ctgccggccctgctggagttctacaagatccactacctggacaccactaccctcatcgag
ccggcgcccaggtatccgagcccgccgatggggtctgtctccgcacctaacctgcctaca
gcagaagaaaatctggagtatgtgcggactctctatgattttcccgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcctggtgatcatagagaagccggaagagcagtgg
tggagtgcccggaacaaggacggccgggtcgggatgatccccgtcccctatgttgagaag
ctcatgaggccttctccgcacgggaagcatggaaacaggaattccagcagctatggcatc
ccggagcccgctcacgcatatgcccagccgcagaccacggctcctctgcctgcagcttcc
agcagtcctggggccaccgtcaaccctttgccatccacacagaatggacctgtctttgca
aaagcaatccagaaacgagtgccctgtgcttatgacaagaccgccttggccttggaggtt
ggtgatatcgtcaaggtcacgcggatgaacatcaacggccagtgggagggcgaggtgaat
gggcgcaaggggctcttccccttcacgcacgtcaagatcatcgaccctcagaacccagac
gagaacgagtga

DBGET integrated database retrieval system