KEGG   Camelus ferus (Wild Bactrian camel): 102511995
Entry
102511995         CDS       T02979                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01524  Platinum drug resistance
cfr03440  Homologous recombination
cfr04064  NF-kappa B signaling pathway
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04210  Apoptosis
cfr04218  Cellular senescence
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05202  Transcriptional misregulation in cancer
cfr05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102511995 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102511995 (ATM)
   04068 FoxO signaling pathway
    102511995 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102511995 (ATM)
   04210 Apoptosis
    102511995 (ATM)
   04115 p53 signaling pathway
    102511995 (ATM)
   04218 Cellular senescence
    102511995 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102511995 (ATM)
   05206 MicroRNAs in cancer
    102511995 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102511995 (ATM)
   05170 Human immunodeficiency virus 1 infection
    102511995 (ATM)
   05165 Human papillomavirus infection
    102511995 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102511995 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102511995 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cfr03032]
    102511995 (ATM)
   03400 DNA repair and recombination proteins [BR:cfr03400]
    102511995 (ATM)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102511995 (ATM)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102511995 (ATM)
DNA replication proteins [BR:cfr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102511995 (ATM)
DNA repair and recombination proteins [BR:cfr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102511995 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 102511995
NCBI-ProteinID: XP_032328400
LinkDB
Position
33
AA seq 3059 aa
MSLALNDLLICCRQLEHDRATERRKEVEKFKRLIQDPETIQHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETECLKTAKPNVSASTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSNRAIYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFELYLKPSQ
DINRVLVARIIQAVTKGCCSQTDKLDRKFLNWDFFPKAIQQARQEKSSAGLNHILEAFVI
FLKTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGARTQ
ETGAYESRKWRSILYNLYDLLVNEISHIGSRGKYSSGARNIAVKENLIELMADVCHQVFN
EGTRSLEISQSYTTTQREFSDCSAPCKKKKIELGWDVIKDHLQKSQNDFDLVPWLQIAAQ
LISKYPASFPSCELSPLLVILCQLLPQQRRGERTPYVSRCLMEVALCQGKKSDLESSQKS
DLLKLWIKIWSITLRGISSEQIQAENFGLLGAIIQGNLVEVDREFWKLFTGSACKPSRSA
VCCLTLALTTCVVPETVKTGMEKSICDVNRNFSLKELIMKWLLFCQLEEDFEDSTELPPI
LHSDFPHLALEKILVSLTMKNCKDAMNFFQSVPECEQHEKSTEEPSFSEAEELFLQTTFD
KMDFLTIVEEHSIEKHKSSVGFSVHQNLKESLDRCLLGLSQQLLNNYSSETSNSEALVRC
SRLLVGVLGCYCYVGVIAEEEAYASELFQKAKSLMQCAGESITLFKNKTNEEFRIVQLRN
MMHLCTSCLYNCAKGSPNKIASGFFLRLLTSKLMNDIADICRSLASIIKKPLDLGEVESV
DNDTHENLMEMEDQSSMSLFNDHPASNVTDANESGESQLTIGATNPLAEEHLSKQDLLVL
DMLKFLCMCVTTAQTNTVSFRAADIRRKLLMLIDSSMLDPTRSLHLHMYLVLLKELPGEE
HPLPMEDVVELLKPLSNVCSLYRRDQDVCKTILNHVLRIVTNLCQEDTDTENTSDAQGQF
LTVIGAFWHLAKEGKCTFSVRMALVKCLKTLLEADPYSKWAILNVMKEDFPVNEIFPQFL
ADSHHQVCMLAAESVNRLFQHMEQGHSSTLLKALPLKLQQTAFENAYLKAQEGMREVKSH
RAENPEFLDEICNRKAILLMMIAVVLCCSPVCEKQALFALCKSVKENGLEPHLIKKVLEK
VSETFGYRHLEDFMASHLDYLVLEWLNLQYSLSSFPFILLNYTNIEDFYRSCYKVLIPHL
VIRSHFDEVKSIANQIQEDWKHLLTDCFPKILVNILPYFAYEGTGDSGMAQQRETATKVY
DMLKDENLLGKQIDHLFISNLPEIVVELLMTLHEPATSGASQSTDPCDFSGDLDPAPNPP
HFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICVQAAETNNVYKKHRIL
KIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINKRPARFTGVSLRSFSLCCDLLS
RVCHTAVTHCKDALENHLHVIVGTLIPLVDDQMEVQKQVLDLLKYLVIDNKDNENLYITI
KLLDPFPDHVAFKDLRITQQKIKYSRGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRR
QLEQHKDQMMDLMRASQDNPQDGMMVKLVVGLLQLSKMAANHTGEKEVLEAVGSCLGEVG
PVDFSTIAIQHNRDTSCTKALELFEDKELQWTFIMLTYLNSTLIEDCVKVRSAAVTCLKS
ILATKTGHSFWEIYKTTTDPMLTYLQPFRTSRKKFLEVPRLEKESPLEGLDDTNLWIPQS
ENHDIWIKTLTCAFLDSGGTKSEVLQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWR
NLLSTHIQGFFTYCFRQSSQTSRSTTPANLDSESEHFFRCCLDKKSQRTMLAVVDYLRRQ
KRPSSGTVFEDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKNMDDQERRNLTFEE
GSQSTTISCLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYEHE
AMWGKALVTYDLETAIPSSTRQAGIIQALQNLGLCHILSVYLKRLDHENKEWCAELQELH
YQAAWRGMQWDHCVSVNKRIEGTSYHESLYNALQALRDREFSTFYESLKYARVKEVEELC
KGSLESVYSLYPTLSRLQAIGELEDIGELLSRSVMDRQPSEVYSKWWKHSQLLKDSDFSF
QEPIMALRTVILEILIEKEVENSQRECFKDILTKHLIELSTLARTFKNTQLPERAIFQIK
QYNPASCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASYLEMQNDPNLKLIYTEC
LRVCGTWLAETCLENPAVIMQTYLEKAVEVAGSYEGESNDGLRNGKMKAFLSLARFSDTQ
YQRIENYMKSSEFENKQALLRRAKEEVGLLREHKIQTNRYTVKVQRELELDECALHALKE
DRKRFLCKAVENYISCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKFL
PLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKPEA
ARRSRIPKNAPKQSSQLDEDRIEAANKIIRTIRSRRPQMVRSVEALCDAYIILANLDATQ
WKTQRRGISIPADQPITKLKNLEDVVVPTMEIKVDPTGEYRNLVTIQSFKAEFRLAGGLN
LPKIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKV
VPLSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSALQCQKKMMEVQKKSFEDKY
ETFMDICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNIL
INEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEV
MRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESEFHSTLNAEDQECKRTRSD
TDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKPWV
NT seq 9180 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaacatgatagagct
acagaacgaaggaaagaggttgagaaatttaagcgcctgattcaggatcctgaaaccatt
caacatttagatcggcattcagattccaaacaaggcaaatacttgaattgggatgctgtt
tttagatttttacagaagtatattcagaaagaaacagaatgtttgaaaacagcaaaacca
aatgtatcagcctcgacacaagccaccaggcagaaaaagatgcaagaaatcagtagcttg
gtcaaatacttcatcaaatgtgcaaataaaagagcaccccgactaaaatgtcaagaactc
ttgaattatatcatggatacagtgaaggattcatctaatagagccatttatggggccgat
tgcagcaacatattgctgaaggacattctttcagtaaggaaatactggtgtgaaatatct
cagcaacagtggctagaattattctctgtgtactttgagctgtatcttaaaccttcacag
gacattaatagagttttggtggctagaataattcaagctgtgaccaaaggatgctgttca
cagactgataaattagatcgtaaatttctgaattgggatttttttcctaaggctattcag
caagcaagacaagaaaagagctctgcaggcctaaatcatatcttagaagcgtttgttatc
ttcctcaagactttggctgttaactttcgaattcgcgtgtgtgaattaggagatgaaatt
ctccctactttgctttatatttggactcagcatagacttaatgattccttaaaagaagta
attattgaattatttcaactacaaatttatatccatcatccaaagggagccagaactcaa
gaaacaggtgcttatgaatcaagaaaatggagaagtatcttatacaacctatatgaccta
ctagttaatgaaataagtcatataggaagcagagggaaatattcttcaggagctcgtaat
attgctgtcaaggaaaacttgattgaattgatggcagatgtttgtcaccaggtttttaat
gaaggtaccagatctctggaaatttctcagtcgtatacaaccacacaaagagaatttagt
gattgcagtgcaccttgcaaaaagaagaaaatagaattaggctgggatgtaataaaagat
catcttcagaagtcacagaatgattttgatcttgtgccttggttacagattgcagctcag
ttaatatcaaaataccctgcaagtttccctagctgtgagctgtcaccattgctagtgata
ctgtgccagcttctgcctcagcagcgacgtggggaacggacgccgtatgtgtcgcgatgc
cttatggaagttgcactgtgtcaaggcaagaaatcagacctcgaaagctctcaaaagtca
gatttattgaaactctggattaaaatttggtctattacccttcgcggtataagttctgaa
caaatacaagctgaaaactttggcttacttggagccataattcaaggtaatttagttgaa
gttgacagagaattctggaaattattcactggatcagcttgcaaaccttcacgttctgca
gtatgctgtttgactttggcgctgaccacctgtgtagtcccagaaacagtaaaaacagga
atggagaagagtatatgtgatgtaaacagaaatttttctttaaaagaattgataatgaag
tggctcttattctgtcagttagaggaagactttgaagacagtacagagctgcctccgatt
cttcacagtgattttcctcatcttgccctggagaaaattcttgtgagtctcactatgaaa
aactgtaaggatgcaatgaactttttccaaagtgtgccagaatgtgagcagcatgaaaaa
agtacagaagagccttcattctcagaagccgaagaactgtttcttcagacgacttttgac
aagatggattttttaaccattgtagaagagcatagtatagaaaagcacaaatccagtgta
gggttttctgtccaccaaaatctcaaggaatcactggatcgctgtcttctgggattatca
caacagcttctaaataactactcatctgagacttcaaattcagaagcgcttgtccggtgt
tcacgccttctggtgggtgttctcggctgctattgctatgtgggtgtgatagctgaagag
gaagcatatgcatcagaattattccagaaagccaagtctctaatgcagtgtgcaggagaa
agtatcactctgtttaaaaataagacaaatgaggagttcagaattgttcagctgagaaat
atgatgcatctgtgtacaagttgcttgtataactgtgccaagggcagtccaaataagatt
gcatctggctttttcttacgattattaacatcaaagctaatgaatgatattgcagatatt
tgtagaagtttagcatccattatcaaaaagccgttggatttgggagaagtagaatcagtg
gacaatgatactcatgaaaatctaatggagatggaggatcagtcttccatgagtctattt
aatgatcaccctgctagtaacgttactgatgcaaatgaatctggggagagccagctcact
attggtgccacgaatcctttagctgaagaacatctgtcaaagcaagatctacttgttttg
gacatgctcaagttcttgtgtatgtgtgtgaccactgctcaaaccaatactgtgtcattt
agagcagctgatattcggaggaaattgttaatgttaattgattctagcatgctagaccct
accagatctctccacctacacatgtatctagtgcttttaaaggaacttcctggagaagaa
catcccttgccaatggaagatgttgttgaacttctaaaaccactatccaatgtgtgttct
ttgtatcgccgtgaccaagatgtttgtaaaaccattttaaaccatgtccttcgtatagtg
acgaacctgtgtcaagaagatacggacactgagaacacaagtgatgctcaaggacagttt
cttacagtgattggagcattttggcacttagcaaaggagggaaaatgcacattctctgta
agaatggcactagtaaaatgccttaaaactttgcttgaggctgatccttattcaaaatgg
gctattctaaatgtaatgaaagaagactttcctgtaaacgaaatatttccgcagtttctt
gctgatagtcatcaccaagtttgcatgttggctgcagaatcagtcaatagattatttcag
catatggaacaaggacattcttctacattattgaaagcacttcctctgaagcttcagcaa
acagcttttgaaaatgcctacttgaaagctcaggaaggaatgagagaagtgaagtcccac
agagctgagaaccctgaatttttggatgagatttgtaataggaaagccattttactgatg
atgatagctgtggtgttatgctgtagccctgtctgtgaaaaacaggctttgttcgcgctt
tgcaagtctgtgaaagagaatggattagagcctcacctcattaaaaaggttttagagaaa
gtttctgaaacttttggatacagacatttagaagacttcatggcttctcacttggattat
ctggttttggaatggctaaatcttcaatacagcttatcttcttttccttttattttgtta
aactacacaaacattgaggatttctataggtcttgttataaagttttgattccacatctg
gtgattagaagtcattttgatgaggtgaagtccattgctaatcagattcaagaggattgg
aaacatcttctgacagattgctttccaaagattcttgtaaatattcttccatacttcgct
tatgagggtaccggagacagtgggatggcgcagcaaagagagactgctaccaaagtctat
gatatgcttaaagatgaaaacttattaggaaaacagattgatcacttattcattagtaat
ttaccagagattgtggtggagttactgatgacgttacacgaaccagcaacgtctggtgcc
agccagagcactgacccctgtgatttttcaggggatttggatcctgctcccaatccacct
cattttccatcacatgtgattaaagcaacatttgcctatatcagtaattgccataaaaca
aagcttaaaagcattttagaaattctttccaaaagtcctgactcctatcagaaaatcctc
ctagccatatgtgtgcaagcagctgagacaaacaatgtttataaaaagcacagaattctt
aaaatatatcacctgtttgttagtttattactgaaagatataaagagtggcttaggtgga
gcttgggcctttgttcttcgagatgttatttatactttgattcactatatcaacaaaagg
cctgctcgtttcacgggtgtgtcattacgtagcttctccctttgttgtgacctgttaagc
cgggtttgccacacagcagtaactcactgtaaggatgctttagaaaatcatcttcatgtt
atcgttggtacacttataccccttgtggatgatcagatggaggttcagaaacaggtattg
gacttgttgaaatacttagtgattgataacaaggataatgaaaacctatatatcacgatt
aaacttttagatccttttcctgaccacgttgcctttaaggatttacgtattactcagcag
aaaatcaaatacagtagaggacccttttcactcttggaggaaattaaccattttctctca
gtaagtgtttatgacgcacttcccttgacacggcttgaaggactgaaggatcttcgaaga
caactagagcaacataaagatcagatgatggatcttatgagagcatctcaggataacccg
caggatggcatgatggtgaagctggttgtcggcttgttgcagttatccaagatggcagca
aaccacactggtgaaaaagaagttttagaggctgttggaagctgcttgggagaagtgggt
cctgtagatttctctacaatagcgatacaacataacagggacacgtcgtgtaccaaggct
cttgagttatttgaagataaagagcttcagtggaccttcataatgctgacctacctgaac
agtacactgatagaagattgtgtcaaagtgcgatcagcagctgttacctgtttgaaaagc
attttagccacaaaaactggacatagtttctgggagatttataagacgacaactgatccc
atgctgacctatctacagccttttcgaacatcaagaaaaaagtttttagaagtacccaga
cttgagaaagaaagccctttagaaggcttggatgatacaaacctgtggattcctcaaagt
gaaaatcatgacatttggataaagacactgacttgtgcttttttggatagtggaggcaca
aaaagtgaagttctgcagttattaaagccaatgtgtgaagtgaaaactgacttttgtcag
actgtgcttccatacttgattcatgatattttactgcaagatacaaatgaatcatggaga
aatctgctttctacacatattcagggatttttcacttactgcttcagacagtcctcacaa
acaagccggtccacaacccctgcaaatttggattcagagtccgagcactttttccgatgc
tgtttggacaaaaaatcacagagaacaatgcttgctgttgtggactacttgaggagacaa
aagagaccttcctcaggaacagtttttgaagatgctttctggctggagttgaattaccta
gaggttgccaaggtagctcagtcttgtgctgctcactttacagcattgctttatgcagaa
atctatgcagataaaaagaacatggatgatcaagagagaagaaatcttacatttgaagaa
ggaagccaaagtacaactatttcctgtttgagtgaaaaaagtaaagaagaaactggaata
agtttacaggatctgctcttagaaatctacagaagtataggagagccagatagtctttat
ggctgtggtggagggaaaatgttacaaccccttactagactacgaacatatgaacatgaa
gcgatgtgggggaaagccctggtaacatatgaccttgagacggcaatcccctcatcaact
cgccaggcgggaataattcaggccttgcagaatttgggactctgccatattctttccgtc
tatttaaaacgattagatcatgaaaataaagagtggtgtgctgagctacaggaactgcat
taccaagcagcatggaggggcatgcagtgggaccactgtgtttctgtcaacaaaaggata
gaaggaaccagttaccacgaatcattgtacaatgctctacaggctctaagagacagagaa
ttctccactttttatgaaagtctcaagtatgccagagttaaagaagtggaggagctgtgt
aagggcagccttgagtctgtgtattccctctaccccacgctcagcagactgcaggccatc
ggagagcttgaggacatcggggagcttttgtcaagatcagtgatggataggcagccctct
gaagtatacagtaagtggtggaaacactcccagcttctgaaagacagtgattttagtttt
caggagcctataatggctctacgcacagtcattttggagatcttgatagaaaaggaagtg
gagaactcccagagagagtgttttaaggacattctcaccaagcaccttatagaactctcc
acactagcccgaactttcaagaacactcagctccctgaaagggcaatatttcaaattaaa
cagtataatccagctagctgtggagtctctgagtggcagctggaggaagcacaagtgttc
tgggcaaaaaaggaacagagtcttgccctgagcattctcaagcagatgatcaagaagttg
gatgccagttatttagagatgcagaatgatcccaacctaaaacttatatacacggaatgt
ctgagggtgtgtggcacctggttagcagaaacttgcttagaaaatcctgctgtcattatg
cagacttacctagaaaaggcagtggaagttgctggaagttatgaaggagaaagcaatgat
gggctcagaaatggaaaaatgaaggcgtttctctcattagcacggttctcagatacccag
taccaaagaattgaaaactatatgaagtcatcagaatttgaaaacaagcaagctctcctg
agaagagccaaagaggaagtgggccttcttagggaacataaaattcagaccaacagatac
accgtaaaggttcagcgagagctggagctggatgaatgtgcgctccatgcgttgaaagaa
gatcgtaaacgtttcttatgtaaagcagttgaaaattacatcagttgcttactaagtgga
gaggggcatgacatgtggatattccgtctttgttccctctggcttgaaaattctggagtt
tctgaggtcaatggcatgatgaagagagatggaatgaagattccgtcatataaatttttg
cctcttatgtaccagttggctgctagaatggggaccaagatgatgggaggcctaggattt
catgaagtcctcaataacctcatctctagaatttcaatggatcaccctcatcatactttg
tttattatactggccttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggca
gcaagaaggagcagaatacctaaaaacgcacctaaacagagctcgcagcttgacgaggat
cgaattgaggctgcaaacaaaataatacgtactatcagaagtaggaggcctcagatggtc
agaagtgttgaggcactttgtgatgcttacattatattagcaaacttggatgccactcag
tggaagacccagagaagaggcataagcattccagcagaccagcccatcactaaactgaaa
aacttagaagacgttgttgtccctactatggaaattaaggtggaccccacaggagaatat
agaaatctggtgactattcagtcatttaaagcagaatttcgtttagcaggaggtttaaat
ttaccaaaaataatagattgtttgggctctgatggcaaagaaaggagacagcttgtcaag
ggccgggatgacctgagacaagatgctgtcatgcagcaggttttccagatgtgtaataca
ttactgcagagaaacactgaaaccaggaagaggaaactgactatctgcacgtataaggtg
gttcccctttctcagcgaagtggtgtccttgaatggtgcacaggaactgtccctattggt
gaatttcttgttaacaatgagaatggtgctcataaaagatacaggccaaaggatttcagt
gcccttcagtgccaaaagaaaatgatggaagtgcaaaagaagtcttttgaagacaaatac
gaaaccttcatggatatttgccaaaattttcaaccagttttccgttacttctgcatggaa
aaattcttggatccagctgtttggtttgagaagcggttagcttatacgcggagtgtggct
acttcttctattgttggttacatacttggacttggggatagacacgtacagaacatcttg
ataaacgagcagtcagccgagctcgtacatatagatttaggagttgcctttgaacagggt
aaaatccttcccactcctgaaacagttccttttaggctcaccagagatattgtggatggg
atgggcattaccggtgttgaaggtgtctttagaagatgctgtgagaaaaccatggaggtt
atgagaaactctcaggaaaccctgttaactattgtggaggtcctcctgtatgaccctctc
tttgactggaccatgaatcctctgaaagctttgtatttacagcagaggccagaagacgaa
agtgagttccactccactctgaacgcagaggaccaggaatgcaaacgaacccgcagtgat
actgaccagagtttcaacaaagtagctgaacgtgtcttgatgagactgcaagagaaactg
aaaggagtggaggagggaaccgtgctcagcgtgggtggacaggtgaatttgctcatccag
caggccatggaccccaaaaatctcagccggcttttcccaggatggaaaccttgggtgtga

DBGET integrated database retrieval system