KEGG   Camelus ferus (Wild Bactrian camel): 102512136
Entry
102512136         CDS       T02979                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04151  PI3K-Akt signaling pathway
cfr04210  Apoptosis
cfr04630  JAK-STAT signaling pathway
cfr04640  Hematopoietic cell lineage
cfr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102512136 (IL3RA)
   04151 PI3K-Akt signaling pathway
    102512136 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102512136 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102512136 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102512136 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102512136 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cfr04050]
    102512136 (IL3RA)
   04090 CD molecules [BR:cfr04090]
    102512136 (IL3RA)
Cytokine receptors [BR:cfr04050]
 Interleukin receptor families
  IL3 receptor family
   102512136 (IL3RA)
CD molecules [BR:cfr04090]
 Proteins
  102512136 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 102512136
NCBI-ProteinID: XP_032330337
LinkDB
Position
X
AA seq 378 aa
MGAAFAMAFLWLAVCLTPISCLLQMDQDPDPVIKNLRMDPERKRMSWDLHGNVSQIWCFV
NSRRAHKARNNTYCKFAHIPCQATNYSVSVTQGPPFSGWIQHPKLEGKARAAAENLTCWV
HDADLLTCTWAVGREAPRDTQYHLYLENLHSLQKWPCSQYRQDEWGTNVECRFDDLSVLS
PELNRFSVNGSSRESPIPCSEITKTLHEIERLTAPTITSAWCNQTYSIVQWQVRSHFRED
FEYELEMQQGAHLEHKQTEDNFLKLSNPGTYTVRIRARHTAMLAPSWGEWSVRERFVCGR
APLPVWLTSLLIALGTLLALALVLLLCRRYAVMQQLFPPIPHVKDPISDHLQNERMMAWE
EEKQQECPVAEVQILGEN
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgggggctgccttcgccatggccttcctctggctggcggtgtgcctgacgcccatctcc
tgcctgctgcagatggaccaggatccagacccagtgattaagaacttaaggatggatcca
gagagaaaaaggatgagctgggacctccacggaaatgtttcccaaatttggtgctttgtg
aattcaagacgtgcccataaggcacgaaacaacacttactgcaaatttgctcacatcccg
tgccaagcgaccaactacagcgtgagtgtgacccaggggccaccgttctccgggtggatt
cagcaccctaagctggaagggaaggccagggcggcggcagagaacctgacctgctgggtt
cacgacgcggacttgctgacgtgcacctgggcggtgggcagggaggccccgcgggacacg
cagtatcacctgtacctggagaacctacattccttgcagaagtggccgtgctcccagtac
agacaggacgagtgggggacaaacgtcgagtgtcgtttcgacgacctctctgtattgtcc
ccggagctgaaccgtttctctgtcaatggcagcagccgagagtccccgatcccctgctct
gaaatcacaaaaacattacacgaaattgagagactgactgcgcccaccatcacgagtgcc
tggtgcaaccagacctattccatcgtccagtggcaggtgcgcagccacttcagggaggac
ttcgagtatgaacttgaaatgcagcagggcgcgcacctcgaacacaaacagactgaggac
aacttcctgaagctgagcaatcctggaacctacaccgtgagaataagagccaggcacacg
gccatgctggccccctcgtggggcgaatggagtgtccgggagcgcttcgtatgtggccgc
gcgcccctcccggtgtggctgacctctttgctgatcgcgctggggacgctgctcgcgctg
gcgctggtgctcctgctttgcagaaggtacgcggtgatgcagcagctgttcccgcccatc
cctcacgtgaaagaccccatcagtgaccaccttcagaacgagaggatgatggcctgggag
gaagagaagcagcaggagtgcccagtggcggaggtgcagattttgggggaaaactga

DBGET integrated database retrieval system