KEGG   Camelus ferus (Wild Bactrian camel): 102512293
Entry
102512293         CDS       T02979                                 

Gene name
PCK1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00010  Glycolysis / Gluconeogenesis
cfr00020  Citrate cycle (TCA cycle)
cfr00620  Pyruvate metabolism
cfr01100  Metabolic pathways
cfr03320  PPAR signaling pathway
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04910  Insulin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04931  Insulin resistance
cfr04964  Proximal tubule bicarbonate reclamation
Module
cfr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102512293 (PCK1)
   00020 Citrate cycle (TCA cycle)
    102512293 (PCK1)
   00620 Pyruvate metabolism
    102512293 (PCK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102512293 (PCK1)
   04151 PI3K-Akt signaling pathway
    102512293 (PCK1)
   04152 AMPK signaling pathway
    102512293 (PCK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102512293 (PCK1)
   04922 Glucagon signaling pathway
    102512293 (PCK1)
   04920 Adipocytokine signaling pathway
    102512293 (PCK1)
   03320 PPAR signaling pathway
    102512293 (PCK1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102512293 (PCK1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102512293 (PCK1)
Enzymes [BR:cfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     102512293 (PCK1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 102512293
NCBI-ProteinID: XP_006186193
UniProt: S9XY35
LinkDB
Position
19
AA seq 622 aa
MPPQISDGHSYSAKVIQGSLESLPQAVRDFVESSAKLCQPDQIHICDGSEEENQQLLGRM
EEEGVIKRLKNYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIQLTDSPYVVASMRIMTRMGAPV
LEALGDGEFVKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIVSFGSGYGGNSL
LGKKCFALRIASRLAKEEGWLAEHMLILGLTNPKGQKKYFAAAFPSACGKTNLAMMNPTL
PGWKVECVGDDIAWMKLDSQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQRNTIFTNV
AQTSDGGVYWEGIDQPLASGIRLTSWKNKEWSPEDGEPCAHPNSRFCTPASQCPIIDPAW
ESPEGVPIEGIIFGGRRPTGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPF
AMRPFFGYNFGHYLTHWLSMAQRPAAKLPKIFHVNWFRKDKDGRFLWPGFGENSRVLEWM
FNRINGEGGARPTPIGYVPAEGALDLRGLGDVNVKELFHISKEFWEEEVEEIQKYLEEQV
NADLPYEIRSQVLALKQRISQM
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcctcctcagatctcagacggccacagctactcagccaaagtcatccagggctcgctc
gagagcctgccccaggctgtgagggatttcgtggagagcagcgccaagctgtgtcagcct
gaccagatccacatctgcgatggctccgaggaggagaaccagcagctactgggccgcatg
gaggaagagggtgtcatcaagaggctgaagaattacgacaactgctggttggctctcacc
gaccccagggatgtggccagaattgaaagcaagactgtcattattactcaagagcaacga
gatacggtgcccatccccaaaactggcctcagccagctgggtcgctggatgtccgaggag
gactttgagaaggcatttaatgcccggttcccagggtgcatgaaaggtcgcaccatgtat
gtcatcccgttcagcatggggccgctgggctcacctctgtccaagatcggcatccagctg
accgactcgccctatgtggtggccagcatgcgcatcatgacgcgaatgggcgcgcctgtc
ctggaagcgctgggtgatggagagttcgtcaagtgcctccactctgtgggctgccctttg
cctttaaaaaagcctttggttaacaactgggcctgtaacccagagctgacgctcatcgcc
cacctgcccgaccgcagagagatcgtctccttcgggagtgggtacggtgggaactcgctc
cttgggaagaagtgctttgccctccggatagccagccggctggccaaggaggaggggtgg
ctggcagagcacatgctgattctgggcctaaccaaccccaagggccagaagaagtacttt
gccgctgcgtttcccagtgcctgcgggaagaccaacctggccatgatgaaccccaccctc
ccggggtggaaagtagagtgtgtgggtgatgacatcgcctggatgaagcttgactcacaa
gggaacttacgggctatcaacccagagaatgggttttttggcgttgctcctggaacctct
gtgaagacgaaccccaacgccattaagaccatccagaggaacaccatcttcaccaacgtg
gcccagaccagcgatggcggcgtttactgggaaggcatcgaccagccactggcctcgggc
atcaggctcacttcgtggaagaacaaggagtggagcccggaggatggggagccttgcgcc
caccccaactcgcgcttctgcacccctgccagccagtgccccatcattgacccagcctgg
gagtctccggaaggcgtgcccatcgagggcatcatcttcggagggcgccgacctacaggt
gtccctctggtctatgaagctctcagctggcagcatggagtgtttgtgggggcggccatg
aggtcggaggccacggcagctgcggagcacaagggcaaagtcatcatgcacgaccccttc
gccatgcggcccttcttcggctacaacttcggccactacctgacccactggcttagcatg
gcccagcgcccggcagccaagctgcccaagatcttccacgtcaactggttccggaaggac
aaggacggtaggttcctgtggccaggctttggcgagaactcccgggtgctggagtggatg
ttcaatcgcatcaacggggaaggcggcgccaggcccacgcccatcggctacgtccccgcg
gaaggcgccctggatctgcggggcctgggggacgtcaacgtgaaggagctcttccacatc
tccaaggagttctgggaggaggaggtagaagagatccagaagtacttggaggagcaagtg
aacgctgacctcccctacgagatcaggagccaggtcctggccctgaagcaaaggatcagc
cagatgtaa

KEGG   Camelus ferus (Wild Bactrian camel): 102517725
Entry
102517725         CDS       T02979                                 

Gene name
PCK2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [GTP], mitochondrial
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00010  Glycolysis / Gluconeogenesis
cfr00020  Citrate cycle (TCA cycle)
cfr00620  Pyruvate metabolism
cfr01100  Metabolic pathways
cfr03320  PPAR signaling pathway
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04910  Insulin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04922  Glucagon signaling pathway
cfr04931  Insulin resistance
cfr04964  Proximal tubule bicarbonate reclamation
Module
cfr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102517725 (PCK2)
   00020 Citrate cycle (TCA cycle)
    102517725 (PCK2)
   00620 Pyruvate metabolism
    102517725 (PCK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102517725 (PCK2)
   04151 PI3K-Akt signaling pathway
    102517725 (PCK2)
   04152 AMPK signaling pathway
    102517725 (PCK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102517725 (PCK2)
   04922 Glucagon signaling pathway
    102517725 (PCK2)
   04920 Adipocytokine signaling pathway
    102517725 (PCK2)
   03320 PPAR signaling pathway
    102517725 (PCK2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102517725 (PCK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102517725 (PCK2)
Enzymes [BR:cfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     102517725 (PCK2)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 102517725
NCBI-ProteinID: XP_032337643
LinkDB
Position
6
AA seq 640 aa
MAAVYRPGLRLSWHGLSPWGWSSWRSVQTLRVLSGDLGQVPAKVRDFVEHSARLCQPEGI
HICDGTEAENTAILTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPAGGARGQLGNWMSPAEFQQAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHV
PDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPVGKKRYVAA
AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSDGQLRAINPENGFFGVAPGTSAT
TNPNAMATIQSNTLFTNVAETSDGGVYWEGIDLPLPPGVTVTSWLGKPWKPGDKEPCAHP
NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFSWRHGVFVGSAMRS
ESTAAAEHKGKVIMHDPFAMRPFFGYNFGRYLEHWLSMEGRKGVRLPRIFHVNWFRRDEA
GRFLWPGFGENARVLDWICRRLEGEDSARETSIGLVPKEGALDLSGLGAIDTTQLFSLPK
DFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALEGRVHKM
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggctgctgtgtaccgccccggcctgcggcttagctggcatgggctgagcccctggggc
tggtcatcatggcgcagcgtccagaccctgcgagtcctcagtggagatctgggccaggtg
cctgctaaggttcgagactttgtggagcacagtgcccgcctctgccaaccagagggcatc
cacatctgtgatgggaccgaggctgagaacactgccatactgaccctgctggaacagcag
ggactcatccgaaagctccccaagtacaacaattgctggctggcccgtacagaccccaag
gatgtggcacgagtagagagcaagacggtgattgtaactccttctcaacgggacacggtg
cccctcccggctggtggggcccgtgggcagctgggcaactggatgtccccagctgagttc
cagcaagctgtggatgagaggtttccgggctgcatgcagggccggaccatgtatgtgctt
ccattcagcatgggtcccgtgggctccccactgtcccgcatcggagtgcagctcacggac
tcagcctacgtggtggcgagcatgcgcattatgaccaggttggggacgcccgtgttgcag
gctctgggagatggtgattttgtcaagtgtctgcactccgtgggccagcccctaactggg
caaggggagccggtgagccagtggccatgcaacccagagaaaaccctgattggccatgtg
cccgaccaacgggagatcgtctccttcggcagtggctatggtggcaactccctgctgggc
aagaagtgctttgcccttcgcatcgcctctcggctggcccgggatgagggctggctggcg
gagcacatgctgatcctgggtattaccaaccccgtggggaagaagcgttatgtggcagcc
gccttccccagtgcctgtggcaagacgaacctggccatgatgcggccagcactgccaggc
tggaaagtggagtgtgttggggatgacatcgcctggatgaggtttgacagtgatggtcaa
ctccgggccatcaaccctgagaatggcttctttggagtggcacctggcacctctgccacc
accaaccccaatgccatggccacaatccagagtaacactcttttcaccaacgtggctgag
accagtgatggcggcgtgtattgggagggcattgacctgcctcttccacctggtgtcacc
gtgacctcctggctgggcaaaccctggaaacctggtgacaaggagccttgtgcacatccc
aactctcgcttttgtgccccggctcgccagtgccccatcatggacccagcctgggaggcc
ccggagggtgttcccattgatgccatcatctttggaggtcgcagacccaaaggagtcccc
ctggtttacgaggccttcagctggcgccacggtgtgtttgtgggcagtgccatgcgctca
gagtccactgctgcagctgagcacaaagggaaggtcatcatgcatgacccatttgccatg
cggccctttttcggctacaactttgggcgctaccttgaacactggctgagcatggaaggg
cgcaagggggtccggctgccccgcatcttccatgtcaactggttccggcgtgacgaggca
ggccgcttcctgtggccaggctttggagagaatgctcgggtgctagactggatctgccgg
aggctagaaggggaggacagtgcccgagagacgtccatcgggctggtgccaaaggaaggc
gccttggatctcagcggcctgggagccatagacaccacccagctgttctcactccccaag
gacttctgggaacaggaagttcgtgacattcggagctacctgacagagcaggtcaaccag
gatctgcccaaagaggtgttggctgagctggaggccctggagggacgtgtgcacaaaatg
tga

DBGET integrated database retrieval system