KEGG   Camelus ferus (Wild Bactrian camel): 102512589
Entry
102512589         CDS       T02979                                 

Gene name
PDGFRA
Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04020  Calcium signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04144  Endocytosis
cfr04151  PI3K-Akt signaling pathway
cfr04510  Focal adhesion
cfr04540  Gap junction
cfr04630  JAK-STAT signaling pathway
cfr04810  Regulation of actin cytoskeleton
cfr05163  Human cytomegalovirus infection
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05230  Central carbon metabolism in cancer
cfr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102512589 (PDGFRA)
   04014 Ras signaling pathway
    102512589 (PDGFRA)
   04015 Rap1 signaling pathway
    102512589 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102512589 (PDGFRA)
   04020 Calcium signaling pathway
    102512589 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102512589 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102512589 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102512589 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102512589 (PDGFRA)
   04540 Gap junction
    102512589 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102512589 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102512589 (PDGFRA)
   05206 MicroRNAs in cancer
    102512589 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102512589 (PDGFRA)
   05231 Choline metabolism in cancer
    102512589 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102512589 (PDGFRA)
   05218 Melanoma
    102512589 (PDGFRA)
   05215 Prostate cancer
    102512589 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102512589 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102512589 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102512589 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfr04090]
    102512589 (PDGFRA)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102512589 (PDGFRA)
Protein kinases [BR:cfr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102512589 (PDGFRA)
CD molecules [BR:cfr04090]
 Proteins
  102512589 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 102512589
NCBI-ProteinID: XP_032353285
LinkDB
Position
2
AA seq 1089 aa
MGTSHQTLLVLGCLLTGPSLILCQLSLPSILPNDNEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVKVLEVVSASAAHTGLYTCYYNHTQMEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSGDNVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGELIVVTCAVFNN
EVVDLQWTYPGQVKGKGVTMLEETKVPYIKLVYTLRVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVNLHEVKHFVVDVQAYPPPKISWLKDNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVVENEDDMKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCAAEGTPLPDIEWMICKDIKKCNNETSWTILANNISNIITEVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPGDESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKRGDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatcagacacttctggtcttaggctgtctcctcacagggcccagccta
atcctctgccagctttcattaccctccatccttccaaatgataatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgaaggtgctggaggtggtcagtgcctcggcggcccacacgggtttgtacacctgc
tattacaatcacacacagatggaggagagcgagattgaaggcagacgcatctacatctat
gtgccggacccagatgtagccttcgtacctctagggatgacagattatttggtcatcgtg
gaggatgatgattccgccatcatcccttgtcgcacgactgatccggagactccagtgaca
ttgctcagcggtgacaacgtggtgcacgcctcctatgacagcagacaaggctttaacgga
accttcaccgttgggccctatatctgtgaggccaccgtcagagggaagaagttccagacc
atcccattcaatgtttatgctttaaaagcaacatcagaacttgacctggaaatggaagct
ctgaaaactgtgtataagtcaggggaattgattgtggtcacctgcgccgtctttaacaac
gaagtagttgaccttcagtggacttaccctggacaagtgaagggcaaaggcgtcacgatg
ctggaggaaaccaaggtcccgtacatcaaattggtgtacactctgagggtccccgaggcc
acggtgaaagacagcggagattacgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatttctgtccatgagaaagggtttattgaaatcaaacccaac
ttcagcccattggaagctgtcaacctgcatgaagtcaaacattttgtggtagatgtgcag
gcctacccacctcccaagatatcctggctgaaggacaacctgactctgattgagaatctc
acggagatcactacggacgtagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgggccaaggaagaagacagtggccattataccatcgtagttgaaaacgaggat
gacatgaagagctacacgtttgaactcttaactcaagttccgtcatccattctggacttg
gtcgacgaccaccatggctctaacgggggacagacagtgagatgtgcagctgaagggacc
cctcttcctgacattgagtggatgatttgcaaggatattaagaaatgtaataatgaaact
tcatggacgattttggccaacaatatctccaacatcatcacggaggtccacccccgagac
aggagcacggtggagggccaggtgacatttgccaaagtggaggagaccattgcagttcga
tgcctggcaaagaacctccttggggctgagagccgagaactgaagctggtggcgcccact
ctgcgatctgaactcacagtggcagctgcagtcctggtgctgctggtgatcgtgatcatc
tccctcattgtcctggttgtcatttggaaacagaaaccaaggtatgaaattcgttggagg
gtcattgaatcaatcagccccgatggacatgaatatatttatgtggacccaatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctgggg
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagccggtcccaacct
gtcatgaaagtagctgtgaagatgctaaaacccacagccagatccagtgagaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccacatttaaacattgtgaacttg
ctaggagcctgtaccaagtcaggtcccatttacatcatcactgagtattgcttctacggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgccacccagagaag
ccaaagaaagagctggacatttttggattgaaccctggggatgaaagcacacggagttac
gttattttatcttttgaaaacaatggggactacatggacatgaagcaagctgatactaca
cagtacgtccccatgctggagaggaaagaggtgtctaaatactcagacatccagagatca
ctgtatgatcgcccagcctcgtacaagaagaagtcgatgctagactctgaagtcaaaaac
ctcctgtcagatgataactcagaaggccttactctgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcacaagggaagatcgtgaagatctgtgactttggtctggcc
agagacatcatgcatgattcgaactatgtgtcgaaaggcagcacctttctcccagtgaag
tggatggcccctgaaagcatcttcgacaacctctacaccaccctgagtgacgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcaccccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccggagaagaga
ccctcgttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttacgaaaagatccacctggacttcctgaagagcgaccatcccgccgtggcacgcatg
cgcgtggactccgacaatgcctacattggcgtcacctacaaaaacgaagaggacaagctg
aaggactgggaggggggcctcgacgagcagaggctgagcgcagacagcggctacatcatc
cccttgcccgacatcgaccctgttcctgaggaggaagaccttggcaagaggaacagacac
agctcgcagacgtctgaagagagtgccattgagacaggctccagcagttccaccttcatc
aagagaggggacgagaccatcgaggatatcgacatgatggacgacattggcatagactcc
tcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system