KEGG   Camelus ferus (Wild Bactrian camel): 102512777Help
Entry
102512777         CDS       T02979                                 

Gene name
TGM6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102512777 (TGM6)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102512777 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core CARDB
Motif
Other DBs
NCBI-GeneID: 102512777
NCBI-ProteinID: XP_014416715
LinkDB All DBs
Position
Un
AA seq 730 aa AA seqDB search
MVIGSHAQGGDKQDHLTCPFPAEVKQGIRVTEVDWQRPRNGAAHHTEEYPGPVLVVRRGQ
RFTFTLKMNKPLESEETLIFTVETGPQASEALHTKAVFQTTELEVRNAWTAVKETQAENT
MTVSLISPPNAVIGRYQLSTRVSSRRRNSDRKLGEFILLFNPWCPEDAVFLASEEERQEY
VLSDSGVIFRGVEKHIRAQGWNFGQFEEDILNICLSILDRSLSHQADPATDVSHRHDPIY
VTRAISAMVNSNNDRGVVQGQWQGKYGGGTSPLHWSGSVAILHKWFKGRFKPVKYGQCWV
FAGVMCTVLRCLGIATRVVSNFNSAHDTDRNLTVDKYVDSFGRTLEDLTEDSMWNFHVWN
ESWFARQDLGPSYNGWQVLDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVN
ADYITWLWNEDESRERVYSDTKKIGRCISTKAVGSDSRVDITSLYKYPEGSRKERQVYSK
AVKKLFSMEVSGRRTRVHRASGCGLWRDDLLEPATKPCITGKFKVLEPPVLGHDLKLALC
LGNLTSRAQQVQVNLSGATILYTRRPVAEILHESHAVKLEPQEEKNIPIAISYSQYKKDL
TEDKKILLAAMCLVTRGEKLLVEKDITLEDFITIKVLGPAVVGVAVTVEVMVVNPLSERV
ENCMLTVEGSGLLQGQLSIDVPSLEPQEKASVQFNITPSRSGPRQLQVDLISPHFPDIKG
FVIIHVATAN
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggtcattggcagtcacgcccagggtggtgacaaacaggatcacctaacatgcccgttc
ccagcagaggtcaaacaagggatcagagtcaccgaggtggactggcagcggccaagaaac
ggcgctgcccaccacaccgaggagtacccgggccctgtgctggtcgtccgcaggggccag
aggttcaccttcacgctgaagatgaacaaacccctggagagcgaggagaccctcatcttc
accgtggagacaggaccccaggcctctgaggcccttcacaccaaggctgtgttccagaca
acagagctggaggtgcgcaatgcctggacggctgtgaaggagactcaggcggagaacacc
atgaccgtcagtctcatcagccctcccaacgcagtcattggccgctaccagctgagcacc
agggtgtcctctcgccgcagaaacagtgaccggaagctgggcgagtttattctccttttc
aacccatggtgcccagaggatgccgtgtttctggcctcagaggaggagagacaggagtac
gtgctcagtgacagcggggtcatcttccgaggcgtggagaagcacatccgagcccaaggc
tggaacttcgggcagtttgaggaggacatcctgaacatctgcctctccatcctggaccga
agcctgagtcaccaggctgacccagccaccgacgtgtcccaccgccacgaccccatctac
gtcaccagagccatcagcgccatggtgaacagcaacaatgaccggggcgtggtccaaggc
cagtggcagggcaagtacggcggcggcaccagcccactgcactggagcggcagcgtggcc
attctgcacaagtggttcaagggcaggttcaagccagtcaaatacggccagtgctgggtc
ttcgctggagtcatgtgcacagtccttaggtgcttggggattgcgacacgagttgtgtcc
aactttaactcggcccatgacacagacaggaacctgactgtggacaagtacgtggactcc
tttgggcggacgctggaggacctgacggaagacagcatgtggaatttccatgtctggaat
gagagctggtttgcccggcaggacctgggcccctcttacaatggctggcaggtcctggat
gccaccccgcaggaggagagcgaaggcgtgttccggtgcggccccgcctcagtcaccgcc
attcgcgagggcgacgtgcacctggcccacgatggtccctttgtgtttgcggaggtcaac
gcggactacatcacctggctctggaatgaggatgagagccgcgagcgtgtgtactcagac
actaagaagatcgggaggtgcatcagcaccaaggcggtgggcagcgactcccgcgtggac
atcaccagcctctacaagtatccggaagggtccaggaaggagaggcaggtgtacagcaag
gcggtgaagaagctgttcagcatggaagtgtctggaaggaggacccgggtccacagagcc
agcggctgtggtctctggcgtgatgacctcctggagcctgccaccaagccctgcatcacc
ggcaagttcaaggtgctggagccgcccgtgctgggccatgacctgaagctggccctgtgc
ttgggcaacctcacctcccgggcccagcaggtccaagtcaacctgagcggtgccaccatc
ctttacacccgcaggccggtggcagagatcctgcacgaatcccacgctgtgaagctggag
cctcaagaagagaaaaacatcccaattgcaatatcttactctcaatataagaaagacctg
acagaggacaagaagatcctattggctgccatgtgccttgtcaccagaggagagaagctc
ctggtggagaaggacattactctggaggacttcatcaccatcaaggtgcttggcccagcc
gtggtaggggtggcagttacggtggaagtgatggtggtcaaccccctctctgagagagtg
gagaactgtatgctgacggtggagggcagtggccttctccagggacagctcagcatcgat
gtgcccagcctggagccccaagagaaggcctcagtccaattcaacatcaccccttccagg
agtggcccaaggcagctgcaagtggacctcatcagcccccacttcccggatatcaagggc
tttgtgatcatccacgtggccacagccaactga

DBGET integrated database retrieval system