KEGG   Camelus ferus (Wild Bactrian camel): 102512878
Entry
102512878         CDS       T02979                                 

Gene name
FGFR3
Definition
(RefSeq) fibroblast growth factor receptor 3 isoform X1
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04020  Calcium signaling pathway
cfr04144  Endocytosis
cfr04151  PI3K-Akt signaling pathway
cfr04550  Signaling pathways regulating pluripotency of stem cells
cfr04810  Regulation of actin cytoskeleton
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05219  Bladder cancer
cfr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102512878 (FGFR3)
   04014 Ras signaling pathway
    102512878 (FGFR3)
   04015 Rap1 signaling pathway
    102512878 (FGFR3)
   04020 Calcium signaling pathway
    102512878 (FGFR3)
   04151 PI3K-Akt signaling pathway
    102512878 (FGFR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102512878 (FGFR3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102512878 (FGFR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102512878 (FGFR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102512878 (FGFR3)
   05206 MicroRNAs in cancer
    102512878 (FGFR3)
   05230 Central carbon metabolism in cancer
    102512878 (FGFR3)
  09162 Cancer: specific types
   05219 Bladder cancer
    102512878 (FGFR3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102512878 (FGFR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102512878 (FGFR3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfr04090]
    102512878 (FGFR3)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102512878 (FGFR3)
Protein kinases [BR:cfr01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   102512878 (FGFR3)
CD molecules [BR:cfr04090]
 Proteins
  102512878 (FGFR3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM C2-set_2 Pkinase_fungal
Other DBs
NCBI-GeneID: 102512878
NCBI-ProteinID: XP_032348307
LinkDB
Position
2
AA seq 805 aa
MGAPACALAFCVAVAVVTSAASGSPGMERHVVRRAAEVPGPEPSQRELVFGSGDTVELSC
HLPAVGPTEPTVWVKDGAGLVPSDRVLVGPQRLQVLNASHEDAGAYSCRRPLSQHVLCRF
SVRVTDAPSSGDDEDGEDEAEDTAGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTP
SISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLD
VLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTP
YVTVLKSWISESAEADARLRLANVSARDGGEYLCRASNFVGVAEKAFWLRVHGPQAAEEE
LVEAGEAGSVYAGILSYGVGFLLFILVVATVTLCRLRSPPKKGLGSPAVHKVSRFPLKRQ
QVSLESSSSMSSNTPLVRIARLSSGEGPALANVSELELPADPKWELSRARLTLGKPLGEG
CFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGRHKNIINL
LGACTQGGPLYVLVEYAAKGNLREYLRARRPPGTDYPFDTCRLPAEQLTFKDLVSCAYQV
ARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWM
APEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTH
DLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSVPFEQYSPGGQDTPSSS
SSGDDSVFAHDLLPPAPPGSGASRT
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgggcgccccggcttgcgccctcgcgttctgtgtggccgtggcagttgtgaccagcgct
gcctccgggtccccaggcatggagcgacacgtcgtgcggagggcggcagaggtcccaggc
cctgagcccagccaacgggagctggtctttggcagtggggatactgtggagctgagctgt
cacctgcccgcagtggggcccaccgagcccaccgtctgggtaaaggatggggcagggttg
gtgccttcggaccgcgtcctggtggggcctcagcggctgcaggtgctaaacgcctcccac
gaggacgctggggcctacagctgccggcggccactcagccagcacgtgctgtgccgcttc
agcgtgcgtgtgacagatgctccatcctcgggagatgatgaagatggggaggacgaggct
gaagacacagcaggggccccttactggacacggcctgagcggatggacaagaagctgctg
gccgtgccggctgccaacactgttcgattccgctgcccagccgccggcaaccccactccg
tccatctcctggctgaagaacggcaaggagttccgaggcgagcaccgcattgggggcatc
aagctgcggcaccagcagtggagcctggtcatggagagcgtggtgccctcggaccgcggc
aactacacgtgcgtggtggagaacaagttcggcagcatccggcagacgtacacactggac
gtgctggagcgctctccacaccggcccatcctgcaggcggggctgcccgccaaccagaca
gcggtgctgggcagtgatgtcgagttccactgcaaggtgtacagcgatgcgcagccccac
atccagtggctgaagcacgtggaggtgaacggcagcaaagtggggccagatggcacgccc
tacgtcactgtgcttaagtcgtggatcagtgagagtgcggaggctgacgcacgcctccgc
ctggccaatgtgtccgcgcgcgatgggggcgagtacctctgtcgagcctccaatttcgta
ggcgtggctgagaaggccttttggctgcgtgttcacgggccccaagcagcggaggaggag
ctggtggaggctggtgaggctggcagtgtgtacgcaggcatcctcagctacggggtgggc
ttcctcctcttcatcctggtagtggccaccgtgacgctctgccgcctgcgcagccccccc
aagaagggcctgggctcgcccgccgtgcacaaggtctctcgcttcccgctcaagcgacag
caggtgtccctggagtccagctcttccatgagctccaacacgccgctggtgcggatcgcc
cggctgtcctccggggagggccccgcgctggccaacgtctctgagctcgagctgcctgcc
gaccccaagtgggagctgtcccgggcccggctgaccctgggcaagcctctcggggagggc
tgcttcggccaggtagtcatggcggaggccattggcattgacaaagaccgagctgcgaaa
cccgtcaccgtggcggtgaagatgctgaaagatgacgccacagataaggacctgtcagac
ctggtgtccgagatggagatgatgaagatgattggcagacacaagaacatcatcaacctg
ctgggcgcctgcacccagggcgggcccctgtacgtgctggtggagtacgcggccaagggc
aacctgagggagtacctgcgggcgcggcggcccccgggcacggactaccccttcgacacc
tgcaggctgcccgcggagcagctcaccttcaaggacctggtgtcctgcgcctaccaggtg
gcacgcggcatggagtacctggcctcgcagaagtgtatccacagggacctggcggcccgc
aatgtgctggtgaccgaggacaacgtgatgaagatcgcggactttggcctggcccgcgac
gtgcacaacctcgactactacaaaaaaaccaccaatggccggctccccgtgaagtggatg
gcgcctgaggccttgtttgaccgagtctacacccaccagagtgacgtctggtcctttggg
gtcctgctctgggagatcttcacactggggggctcgccctaccctggcatccccgtggag
gagctcttcaagctgctgaaagaaggccaccgcatggacaagccagccaactgcacacat
gacctgtacatgatcatgagagagtgctggcacgccgcgccctcccagaggcccaccttc
aagcagctggtggaggacctggaccgcgtcctcacagtgacgtccactgacgagtacctg
gacctgtcggtgccctttgagcagtactcgccgggtggccaggacacgcccagctccagc
tcctcgggggatgactccgtgtttgcccacgacctgctgcccccggccccacccggcagc
ggggcctcgcggacgtga

DBGET integrated database retrieval system