KEGG   Camelus ferus (Wild Bactrian camel): 102512958Help
Entry
102512958         CDS       T02979                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01100  Metabolic pathways
Module
cfr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cfr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102512958 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    102512958 (ALDH7A1)
   00620 Pyruvate metabolism
    102512958 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102512958 (ALDH7A1)
   00561 Glycerolipid metabolism
    102512958 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102512958 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    102512958 (ALDH7A1)
   00310 Lysine degradation
    102512958 (ALDH7A1)
   00330 Arginine and proline metabolism
    102512958 (ALDH7A1)
   00340 Histidine metabolism
    102512958 (ALDH7A1)
   00380 Tryptophan metabolism
    102512958 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102512958 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102512958
NCBI-ProteinID: XP_006191513
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MWRVPGLLCVLVARRSKLSGPWNRPAAFMSTLLINQPQYAWLKELGLREENDGVYNGSWG
GRGEVITTYCPANNEPIARVRQASMADYEETVKKAREAWRIWADIPAPKRGEVVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHVLVE
QWNPVGLVGVITAFNFPVAVYGWNNAIAMICGNACLWKGAPTTSLISVAVTKIIAKVLED
NELPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLQESIHDEVVNRLKKAYAQIRVG
NPWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLDHS
APIAHTETFAPILYVFKFKNEDEVFVWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgttcccggtctgctgtgcgtgctcgttgcaaggaggagcaagctctccgga
ccttggaacaggcctgccgccttcatgtccactctgctcatcaatcagccccagtatgct
tggctgaaggagctggggctccgcgaggaaaacgacggcgtgtataatggcagctgggga
ggccggggagaggttatcaccacctattgtcctgctaacaatgagccgatagcaagagtc
agacaggccagcatggctgactacgaagaaactgtaaagaaagcaagagaagcatggaga
atctgggcagatattcctgctccaaagcgaggagaagtagtgagacagattggtgatgcc
ttgcgggagaagatccaagtactaggaagcttggtgtcattggagatggggaagatctta
gtggaaggtgtgggagaagttcaggagtacgtggatatttgtgattatgccgtgggctta
tcacggatgatcgggggacccatcctgccgtctgaaagacccggccacgtgctcgttgaa
cagtggaaccctgtaggcctggtcggagtcatcactgcgttcaacttccctgtggcggtg
tacggctggaacaacgccatcgccatgatctgtgggaatgcctgcctttggaaaggagct
ccaacaacttccctcattagtgtagccgttacaaagataatagccaaggttctggaggac
aacgagctgcctggtgcgatttgttccttgacttgtggtggagcagatatcggcacagca
atggccaaagatgagcgggtgaacctgctgtccttcaccgggagcacccaggtgggaaaa
caggtggcccttatggtgcaggagaggtttgggagaagtttgttagaacttggaggaaac
aatgccatcatagcttttgaggatgcggacctcagcttagtcgttccctcagctctgttt
gcggccgtggggacagccggccagaggtgtaccactgcgaggcgcctgtttttacaagaa
agcatccatgatgaagttgttaatagacttaaaaaggcctacgcacagatccgtgtcggg
aacccatgggactctaatgttctctatgggccgctccacaccaaacaggcagtgagcatg
tttcttggagcagtggaggaagcaaagaaagaaggtggcacagtggtctatggtggcaag
gttatggaccgccctggaaactatgtagagccaacaattgtgacaggtcttgaccacagt
gcgcccattgcacacacagagacttttgccccgattctttatgtgtttaaattcaagaat
gaagatgaggtctttgtgtggaataatgaagtcaaacagggactttcaagtagcatcttt
accaaggatttgggcagaatcttccgctggcttggaccaaaaggatcagactgtggcatt
gtaaacgtcaacattccaacaagtggggctgagattggaggtgcatttggaggagaaaag
cacactggcggtggcagggagtccggtagtgatgcctggaaacagtacatgagaagatct
acttgtaccatcaactacagtaaggaccttcccctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system