KEGG   Camelus ferus (Wild Bactrian camel): 102513729
Entry
102513729         CDS       T02979                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01524  Platinum drug resistance
cfr04141  Protein processing in endoplasmic reticulum
cfr04210  Apoptosis
cfr04215  Apoptosis - multiple species
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05132  Salmonella infection
cfr05160  Hepatitis C
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102513729 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102513729 (BAK1)
   04215 Apoptosis - multiple species
    102513729 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102513729 (BAK1)
   05202 Transcriptional misregulation in cancer
    102513729 (BAK1)
   05206 MicroRNAs in cancer
    102513729 (BAK1)
   05203 Viral carcinogenesis
    102513729 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102513729 (BAK1)
   05212 Pancreatic cancer
    102513729 (BAK1)
   05225 Hepatocellular carcinoma
    102513729 (BAK1)
   05226 Gastric cancer
    102513729 (BAK1)
   05214 Glioma
    102513729 (BAK1)
   05216 Thyroid cancer
    102513729 (BAK1)
   05220 Chronic myeloid leukemia
    102513729 (BAK1)
   05217 Basal cell carcinoma
    102513729 (BAK1)
   05218 Melanoma
    102513729 (BAK1)
   05213 Endometrial cancer
    102513729 (BAK1)
   05224 Breast cancer
    102513729 (BAK1)
   05222 Small cell lung cancer
    102513729 (BAK1)
   05223 Non-small cell lung cancer
    102513729 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102513729 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102513729 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102513729 (BAK1)
   05160 Hepatitis C
    102513729 (BAK1)
   05164 Influenza A
    102513729 (BAK1)
   05162 Measles
    102513729 (BAK1)
   05168 Herpes simplex virus 1 infection
    102513729 (BAK1)
   05163 Human cytomegalovirus infection
    102513729 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102513729 (BAK1)
   05169 Epstein-Barr virus infection
    102513729 (BAK1)
   05165 Human papillomavirus infection
    102513729 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102513729 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cfr03029]
    102513729 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfr02000]
    102513729 (BAK1)
Mitochondrial biogenesis [BR:cfr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102513729 (BAK1)
Transporters [BR:cfr02000]
 Other transporters
  Pores ion channels [TC:1]
   102513729 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 102513729
NCBI-ProteinID: XP_006180558
UniProt: S9X7B8
LinkDB
Position
20
AA seq 211 aa
MASGQGPGPPRQGCGEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTNPEM
DTLPLEPTSTMGQVGRQLAIIGDDINRRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LDLGNGPIRNVLIVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcatccggacaaggtccaggtcctcccaggcaggggtgtggagaacctgatccctcc
tccacttcggaggagcaggtagcccgggacacggaggaggttttccgcagctacgttttt
taccgccatcagcaggagcaggaggctgagggggcagctgcgcccaccaacccagagatg
gacaccttgcccctggaacctaccagcaccatggggcaggtgggtcgccagctcgccatc
atcggggacgacatcaaccggcgctacgactcagagttccaggccatgttgcagcacctg
cagccaacagcagagaatgcctacgagtatttcaccaagattgcctcgagcctgtttgag
agcggcatcaactggggccgagtggtggctctcctgggcttcggctaccgcctggcccta
catgtctaccagcgcggcctgactggcttcctgggccaggtgacccggttcgtggccgac
ttcatgttgcatcactgcattgcccggtggatcgcgcagaggggtggctgggtggcggcc
ctggacttgggaaatggccccatccgcaacgtgctgatagttctggccgtggttttgttg
ggccagtttgtggtacgaaggttcttcaagtcatga

DBGET integrated database retrieval system