KEGG   Camelus ferus (Wild Bactrian camel): 102513737
Entry
102513737         CDS       T02979                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04110  Cell cycle
cfr04218  Cellular senescence
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05212  Pancreatic cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102513737 (E2F3)
   04218 Cellular senescence
    102513737 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102513737 (E2F3)
   05206 MicroRNAs in cancer
    102513737 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102513737 (E2F3)
   05225 Hepatocellular carcinoma
    102513737 (E2F3)
   05226 Gastric cancer
    102513737 (E2F3)
   05214 Glioma
    102513737 (E2F3)
   05220 Chronic myeloid leukemia
    102513737 (E2F3)
   05218 Melanoma
    102513737 (E2F3)
   05219 Bladder cancer
    102513737 (E2F3)
   05215 Prostate cancer
    102513737 (E2F3)
   05224 Breast cancer
    102513737 (E2F3)
   05222 Small cell lung cancer
    102513737 (E2F3)
   05223 Non-small cell lung cancer
    102513737 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102513737 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102513737 (E2F3)
   05161 Hepatitis B
    102513737 (E2F3)
   05160 Hepatitis C
    102513737 (E2F3)
   05163 Human cytomegalovirus infection
    102513737 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102513737 (E2F3)
   05169 Epstein-Barr virus infection
    102513737 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102513737 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102513737 (E2F3)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102513737 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102513737
NCBI-ProteinID: XP_032318462
LinkDB
Position
20
AA seq 467 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFPAAAAAAAAAAPSAYI
QILTTNTSTTSCSSSLQSGSVAAGPLLPSAPGVEQTAGSLLYTTPHGPSSRAGLLQQPPA
LGRGGGGGGGGPPAKRRLELGESGQQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTR
YDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNN
VQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAY
VTYQDIRKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETH
SPMKTNNQDHNGNIPKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNL
EGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttccccgccgccgccgccgccgctgctgccgccgccccgagcgcgtacatc
cagatcctcaccacgaacacttccaccacctcctgttcctcctccctccaaagcggctcc
gtcgccgccggccccctcctccccagtgcccccggcgtggagcagaccgccggcagcctc
ctctacaccacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagcg
ctgggacgcggcggcggcggcggcggcggcggccctccggcaaagcgcaggctggagcta
ggagaaagcggtcagcagtacctctcagatggtttaaaaacccccaagggcaaaggcaga
gctgcgctccgaagtccagatagtccaaaaactccaaaatctccctcagaaaaaacacgg
tatgatacgtcacttggtctgctcaccaagaagttcattcagctactgagccagtcaccg
gatggggtcttggatttgaacaaggcggcagaggtgctgaaggtgcaaaagagaaggatt
tatgacatcaccaatgtcctggaaggcatccacctcattaagaagaagtctaagaacaac
gtgcagtggatgggctgcagtctgtctgaggacgggggcatgctggcccagtgtcaaggc
ctgtcaaaagaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaa
agctgcaccctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttat
gttacatatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtg
aaagcccctccagaaacaagacttgaagtgcctgacccaatagagagcctgcaaatacat
ttggcaagtacccaaggacccattgaggtttatttgtgtccagaagagactgaaacacac
agtccgatgaaaacaaacaaccaagaccacaatgggaatatccctaaacccacttccaaa
gacttggcttcaaccaactcaggacatagtgattgctcgatctctatggcaaacctttct
cctctggcctccccagccaaccttttacagcagactgaggaccaaattccttccaaccta
gaaggaccatttgtgaacttactgcctcccctgctccaagaagactatctgctaagcctt
ggggaggaagaaggcatcagtgatctctttgacgcttatgatttggaaaagctcccgctg
gtggaagactttatgtgtagttga

KEGG   Camelus ferus (Wild Bactrian camel): 102515523
Entry
102515523         CDS       T02979                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04110  Cell cycle
cfr04218  Cellular senescence
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05212  Pancreatic cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102515523 (E2F2)
   04218 Cellular senescence
    102515523 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102515523 (E2F2)
   05206 MicroRNAs in cancer
    102515523 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102515523 (E2F2)
   05225 Hepatocellular carcinoma
    102515523 (E2F2)
   05226 Gastric cancer
    102515523 (E2F2)
   05214 Glioma
    102515523 (E2F2)
   05220 Chronic myeloid leukemia
    102515523 (E2F2)
   05218 Melanoma
    102515523 (E2F2)
   05219 Bladder cancer
    102515523 (E2F2)
   05215 Prostate cancer
    102515523 (E2F2)
   05224 Breast cancer
    102515523 (E2F2)
   05222 Small cell lung cancer
    102515523 (E2F2)
   05223 Non-small cell lung cancer
    102515523 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102515523 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102515523 (E2F2)
   05161 Hepatitis B
    102515523 (E2F2)
   05160 Hepatitis C
    102515523 (E2F2)
   05163 Human cytomegalovirus infection
    102515523 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102515523 (E2F2)
   05169 Epstein-Barr virus infection
    102515523 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102515523 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102515523 (E2F2)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102515523 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102515523
NCBI-ProteinID: XP_014413425
LinkDB
Position
13
AA seq 437 aa
MLRGPRALAPAAGPSPKGLPAMSPTELWSPGLSSPQLCPATTTYYTQLYPQTVPPAAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVPEFRTPKGKSVRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGLFEDPTRPGKQQQLGRELKELMSMEQALDQLIQSCSLNFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRNEENLQIYLKSTQGPIEV
YLCPEEVQEPDSPSKEPLPSTSTLSPSPDSAQPSSSTNLGMTEPMASSAPALTSQQVPLP
PLPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLPCSSPLISFSPPLDQDDYLWGLDGGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcgagggccccgggccctggctccggccgccgggccgtcccccaaggggctgccc
gcgatgagccccaccgagctgtggtcgcctggcctcagcagcccccagctctgcccggcc
accaccacctactacacccagctgtacccgcagactgtgcctccggctgcagcgccaggc
acctgcctcgacgccaccccccacggacctgagggtcaagctgtgcgatgcgtgccggct
ggccggctgccggccaaaaggaagctggacctggaggggatcgggaggcctgcagtccct
gaattccggacccccaaggggaagagcgttagagtggatggcctccccagccccaaaacc
cccaagtcccccggggaaaagactcgctatgacacgtcattggggctgctcaccaagaag
ttcatttacctcctgagcgagtctgaggatggggtcctggacctgaactgggctgccgag
gtgctggatgtgcagaagcgccgcatctatgacatcaccaatgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggactatttgaagac
cccactcggccggggaagcagcagcagctggggcgggagctgaaggagctgatgagcatg
gagcaggccttggaccagctcatccagagctgttctctgaacttcaagcacttgacggag
gacaaggccaacaagagactggcctatgtgacttaccaggacatccgtgctgtgggcaac
tttaaggagcagacggtgatcgctgtcaaggcccctccgcagacaagactggaagtgcct
gacaggaacgaggaaaacctgcagatatatttgaagagcacgcaggggcctatcgaagtc
tacctgtgcccagaagaggtgcaggagcccgacagtccttccaaggagcccctcccctcc
acctccaccctcagccccagccctgactctgctcagcccagcagcagcaccaaccttggg
atgacagaacccatggcatcgtcagcgccagcactgacgtcccagcaggtcccgctgccg
cccctgccatcccttgtccccctggaggccaccgacagcatgctggagctgccacaccca
ctcctgcagcagaccgaggaccagttcctgtcccccaccctaccgtgcagctcccctctg
atcagcttctccccgcccttggatcaggacgactacctgtggggcctggatggaggggag
ggcatcagtgacctcttcgactcatatgaccttggggacctgctgattaactga

KEGG   Camelus ferus (Wild Bactrian camel): 102517851
Entry
102517851         CDS       T02979                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04110  Cell cycle
cfr04137  Mitophagy - animal
cfr04218  Cellular senescence
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05212  Pancreatic cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102517851 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    102517851 (E2F1)
   04218 Cellular senescence
    102517851 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102517851 (E2F1)
   05206 MicroRNAs in cancer
    102517851 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102517851 (E2F1)
   05225 Hepatocellular carcinoma
    102517851 (E2F1)
   05226 Gastric cancer
    102517851 (E2F1)
   05214 Glioma
    102517851 (E2F1)
   05220 Chronic myeloid leukemia
    102517851 (E2F1)
   05218 Melanoma
    102517851 (E2F1)
   05219 Bladder cancer
    102517851 (E2F1)
   05215 Prostate cancer
    102517851 (E2F1)
   05224 Breast cancer
    102517851 (E2F1)
   05222 Small cell lung cancer
    102517851 (E2F1)
   05223 Non-small cell lung cancer
    102517851 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102517851 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102517851 (E2F1)
   05161 Hepatitis B
    102517851 (E2F1)
   05160 Hepatitis C
    102517851 (E2F1)
   05163 Human cytomegalovirus infection
    102517851 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102517851 (E2F1)
   05169 Epstein-Barr virus infection
    102517851 (E2F1)
   05165 Human papillomavirus infection
    102517851 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102517851 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102517851 (E2F1)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102517851 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 102517851
NCBI-ProteinID: XP_032318011
LinkDB
Position
19
AA seq 437 aa
MAVAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISTAQDASAPPAPAGPAAPTAGPRD
PDLLLFATPQAPRPTPSAQRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHAAVGIGGRLEGLTQDLRQLQESERQLDHLIHICTTQLRLLSEDADS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPE
ESAGGISPGKTPSQGAASGEEDRAADPATTVPPPPSSPPSSPATDPSQSLLSLEQEPLLS
RMGGLRAPADEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccgtggcaggggcccccgctggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccacggcgcag
gacgccagcgccccgccggcccccgccggcccggccgcgcccacagccggcccccgcgac
cccgacctgctgctcttcgccacgccgcaggcgccccggcccacacccagcgcgcagcgc
ccggcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcagtac
ctggctgagagcagcgggccagctcggggcagaggccgccacccaggaaaaggtgtgaaa
tcgccaggggagaagtcacgctatgagacatcgctgaatctgaccaccaaacgcttcctg
gagttgctgagccgctcggctgatggtgttgtcgacctgaactgggcagcggaggtgctg
aaagtgcagaaacggcgcatctacgacatcaccaacgtcctcgagggcatccagctcatt
gccaagaagtccaagaatcacatccagtggctaggcagccacgcagcagtggggattggt
gggcggcttgaaggactgacccaggacctccggcaactgcaggagagcgagcggcagctg
gaccacctgatccatatctgcaccacacagctgcgtctgctttccgaggatgctgacagc
cagcgcctggcctacgtgacctgccaggaccttcgtagcatcgccgaccctgcagagcag
atggtcatggtgatcaaggcccctcccgagacccagcttcaagccgtggactcctcagag
acctttcagatctcccttaagagcaaacaaggccccatcgacgttttcctgtgccctgag
gagagtgcgggcgggatcagccctgggaagaccccgtcccagggggcagcttccggggag
gaggacagggcagctgaccctgccaccacagtgccaccaccaccatcatctcccccctca
tcccctgccacggatcccagtcagtccctactcagcctggagcaagaacctctgctttcc
cggatgggtggcctgcgggcccccgcggacgaggaccgcctgtccccgctggtggcggcc
gattcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatc
agcctatcccccccccatgaggccctcgactaccactttggccttgaagagggcgagggc
atcagagacctcttcgactgtgactttggggaccttactcccctggatttctga

DBGET integrated database retrieval system