KEGG   Camelus ferus (Wild Bactrian camel): 102513829
Entry
102513829         CDS       T02979                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04390  Hippo signaling pathway
cfr04810  Regulation of actin cytoskeleton
cfr05200  Pathways in cancer
cfr05218  Melanoma
cfr05224  Breast cancer
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102513829 (FGF1)
   04014 Ras signaling pathway
    102513829 (FGF1)
   04015 Rap1 signaling pathway
    102513829 (FGF1)
   04390 Hippo signaling pathway
    102513829 (FGF1)
   04151 PI3K-Akt signaling pathway
    102513829 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102513829 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102513829 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102513829 (FGF1)
   05218 Melanoma
    102513829 (FGF1)
   05224 Breast cancer
    102513829 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102513829 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:cfr00536]
    102513829 (FGF1)
Cytokines and growth factors [BR:cfr04052]
 Growth factors
  Growth factors (RTK binding)
   102513829 (FGF1)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102513829 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102513829
NCBI-ProteinID: XP_014414429
UniProt: S9Y262
LinkDB
Position
3
AA seq 155 aa
MAEGEITTFAALREKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccaccttcgcggccctcagggagaagtttaacctgcctccg
gggaactacaagaaacccaaactcctctactgcagcaacgggggccacttcctgaggatc
cttccagatggcactgtggatgggaccagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttgtacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacgtccaagaagcacgccgaaaag
aattggtttgttggtctcaagaagaatggaagctgcaaacgcggtcctcggactcactac
ggccagaaggcgatcttgtttctccccttgccagtctcctctgattaa

DBGET integrated database retrieval system