KEGG   Camelus ferus (Wild Bactrian camel): 102514409
Entry
102514409         CDS       T02979                                 

Gene name
BCL6
Definition
(RefSeq) B-cell lymphoma 6 protein
  KO
K15618  B-cell lymphoma 6 protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102514409 (BCL6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102514409 (BCL6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102514409 (BCL6)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    102514409 (BCL6)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-C2H2_jaz DZR zf-C2HE zf-C2H2_6 DUF3342 Zn-ribbon_8
Other DBs
NCBI-GeneID: 102514409
NCBI-ProteinID: XP_006188915
LinkDB
Position
1
AA seq 706 aa
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVPAIKPPREEFLNGRMLMPQDIMAYRGREVVENSLPLRSAPGCESRAF
APSLYNGLSTPPASYPVYSHLPVSSFLFSDEELRDARMPVANPFPKERALPCDSARPVPS
EYSRPAMEIPPGVCHSSIYSPKEAAPEEARSDMHYSVAEGPKPAAPSARSAPYFPCDKAG
KEEERPSSEDEIALHFEPPSAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQTSG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEPAELGRLSPRAYAAPPACQPPMEP
ENLDLQSPTKLSTSAEDSTIPQASRLNNIVSRSLTGSPRSSSESHSPLYLHPPKCTSCGS
QSPQHTEMCLHAAGPTFPEELGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcctcgccggctgacagctgtatccagtttacccgccacgccagtgatgtccttctc
aaccttaatcgcctccggagccgtgacatcctgactgatgttgtcatagtggtgagccgg
gagcagtttagagcccataagacagtcctcatggcctgcagtggcctcttctacagcatc
ttcacagaccagttgaaatgcaaccttagcgtgatcaatctggatcccgagatcaaccca
gaggggttctgcatcctcctggacttcatgtacacgtcccggctcaacctgcgggagggc
aacatcatggccgtgatggccacagcgatgtacctgcagatggagcatgtcgtggacact
tgccggaagtttatcaaggccagtgaagcagaaatggttccggccatcaagcctccccgt
gaagagttcctgaatggccggatgctgatgccccaggacatcatggcctaccggggtcgc
gaggtggtggagaacagcctgccactgaggagcgcccccgggtgtgagagcagagccttc
gcccccagcctgtacaatggcctgtccacgccacctgcctcataccccgtgtatagccac
ctccctgtcagcagcttcctcttctctgacgaggagctgcgggatgcccggatgcctgtg
gccaaccccttccccaaggagcgggccctcccctgcgatagtgccaggccggtccccagt
gagtacagtcggccggccatggagataccccccggcgtgtgccacagcagcatctactcg
cccaaggaggcagccccagaggaggcccggagtgacatgcactacagcgtagctgagggc
cccaagccagccgccccctcagcccggagcgccccgtacttcccctgtgacaaggctggc
aaggaggaagagcggccgtcctcagaggatgagatcgccctgcatttcgagccccccagc
gcacccctgaacaggaagggcctggtgagtcctcagagcccccagaaatccgactgccag
cccaactcgcccacggagtcctgcagcagcaagaacgcctgtatcctccagacctcaggc
tcccctcctgccaagagccccaccgaccccaaagcctgcaactggaagaagtacaagttc
atcgtgctcaacagcctcaatcagaacgccaagcccgaggggcccgagccggccgagctg
ggccgcctttcccctcgcgcctacgctgcccctccggcctgccagccgcccatggagccc
gagaaccttgacctccagtccccaaccaagctcagcaccagtgcggaggactccaccatc
ccacaggccagccggctcaataacatcgtcagcaggtccctgacgggctccccccgcagc
agcagcgagagccactccccgctctacctgcacccgcccaagtgcacgtcctgcggctcg
cagtccccacagcacacggagatgtgcctccatgctgccggccccacgttccccgaggag
ctgggggagacccagtccgagtactcggattccagctgtgagaacggggccttcttctgc
aatgagtgtgactgccgcttctctgaggaggcctcactcaagaggcacacgctgcagacc
cacagtgacaaaccctacaagtgtgaccgctgccaggcctccttccgctacaagggcaac
ctcgccagccacaagaccgtccacacgggcgagaaaccctatcgttgtaacatctgcggg
gcccagttcaaccggccagccaacctgaaaacccacacccggattcactccggagagaag
ccctacaaatgcgaaacatgtggagccagatttgtgcaggtggcccacctccgcgcccac
gtgctcatccacactggcgagaagccctacccctgtgaaatctgcggcacccgcttccgg
caccttcagactctgaagagtcacctgcgaatccacacgggagagaagccttaccattgc
gaaaagtgcaacctgcatttccgtcacaaaagccagctgcgtcttcacttgcgccagaag
catggggccatcaccaacaccaaggtgcagtaccgcgtgtccgccactgacctgccccca
gagctccccaaagcctgctga

DBGET integrated database retrieval system