KEGG   Camelus ferus (Wild Bactrian camel): 102514558Help
Entry
102514558         CDS       T02979                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00052  Galactose metabolism
cfr00500  Starch and sucrose metabolism
cfr01100  Metabolic pathways
cfr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102514558 (MGAM)
   00500 Starch and sucrose metabolism
    102514558 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102514558 (MGAM)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102514558 (MGAM)
    3.2.1.20  alpha-glucosidase
     102514558 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102514558
NCBI-ProteinID: XP_006185457
LinkDB All DBs
Position
Un
AA seq 1841 aa AA seqDB search
MARKKLKRFTTLELMLSTLLLVVFLITIPLFVLSARDSLKSEDPGTAVTPDPGTTVTPDS
GMSSTPDSAECPAVNELERINCIPDQSPTKATCDQRGCCWKPQGTISVPWCYYSQSHGYR
VEGDLVKTSAGFTAQLDRLPSPSLFGSDVSNVLLTAEYQTSNRFHFKLTDQNKDRYEVPH
EHVQPFQGSAASPLTYDVEVSKQPFSIKVLRRSNSRVLFDSSIGPLLFADQFLQLSTRLP
SANVYGLGEHVHQQYRHDMNWRTWPIFARDTAPTGDGTNLYGAQTFFLCLEDASGLSFGV
FLMNSNAMEVALQPTPALTYRTIGGILDFYVFLGSTPEQVVQEYLELIGRPALPSYWALG
FHLSRYDYGTLDNMKEVVDRNRAAQLPYDVQHADIDYMDARKDFTYDPVNFKGFPEFAKE
LHSNGQKLVIIVDPAISNNSSLSSPYGPYDRGSDVKIWVNASDGVTPLIGEVWPGKTVFP
DFTNPQCTAWWTNEFELFHNQVEFNGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPRVL
DGYLFRKSLCMDAVQHWGKHYDVHSLYGYSMAIATAEAVKTVFPNKRSFILTRSTFAGSG
KFAAHWLGDNAATWSDLQWSIPAMLEFNLFGIPMVGSDICGFTLDAPEELCRRWMQLGAF
YPFSRNHNCQGYKAQDPASFGADSLLLNSSRHYLTVRYTLLPHLYTLFYQAHSRGDTVAR
PLLHEFYADSNTWDVHQQFLWGPSLLITPVLNEGAEKVTAYVPDAVWYDYETGARVRWRK
QRVEMELPGDKIGLHLRGGYIFPTQQPATTTEASRRNPLGLIIALDENKEAKGELFWDDG
ETKDTVANKAYLLCEFSVTQNRLDVKILQSTYTDPNNLVFKEIKILGTQEPTNITVKHNG
VHPSHVSPNVTYDSDLQVALITGIDLVLGEAYTVEWDVKIRDAEKIDCYPDENGASAENC
AARGCVWEESSSPGVPFCYFINDLYSVGDIQYDSHGATAVISLKSSPYAYTLPSTPVSSL
RLDVTYHKDNMLQFKIYDPDNNRYEVPIPLNIPEVPSSTPESRLYEVLIKKNPFGIEVRR
KSTGTVIWDSQLLGFTFNDMFIRISTRLPSQYLYGFGETEHTAFRRDLNWNTWGMFSRDQ
PPGYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVVL
GPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDDMVAAQIPYDVQYA
DIDYMERQLDFTLGPEFAGLPALITRIQADGMRVILILDPAISGNETKPYPAFTRGVEED
VFIKDPSDGSIVWGKVWPDFPNVVVNSSLDWDTQLELYRAYVAFPDFLRNSTITWWKREL
RELYTNPRNPETSLKFDGMWIDMNEPASFVNGAVPPGCKNATLNHPPYMPHLESRDKGLS
SKTLCMESQQILPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGERGIVVTRSTFPSSGR
WGGHWLGDNTAAWDQLRKSIIGMMEFSLFGIPYTGADICGFFQDAEYEMCARWMQLGAFY
PYSRNHNTIGTRRQDPVSWNATFVTLSRSVLRTRYTLLPYLYTLMHVAHVEGSTVVRPLL
HEFVADRVTWDVDGQFLLGPAFLVSPVLQPGAADVTAYFPRARWYDYYTGVDIKARGEWK
SLPAPLDHINLHVRGGYILPWQEPAQNTHLSRQKFLGFKVALDDQGTAEGCLFWDDGQSI
DTYEKGLYYLANFSVSQNTMQSHVIFNKYISDTNPLKLGYVEIWGVGSNSISSVSISVSG
VVVTPSFTYDSTTQVLNIDVTSRNISLHNFTSLTWRSTLSS
NT seq 5526 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaacgtttcactactttggagcttatgctcagcacccttctg
cttgtggtatttctcatcactattcctctgtttgtgctttcagccagagattctttgaaa
tcagaagatcctgggacggcagttactccagatcctgggacaacagttaccccagattcg
gggatgagttccacccctgattctgctgagtgcccagcggtaaacgaattggaacggata
aactgcatccccgaccagtccccaacaaaggccacatgtgaccagcgtggctgctgctgg
aaacctcagggaaccataagtgtgccctggtgctactactctcagagtcacggctatcga
gtggagggcgaccttgtgaagacaagtgcaggattcacagcccagttggacaggttgcct
tctccgtctctgtttgggagtgatgtcagcaacgtgcttctcacagcggaataccagacg
tctaaccgcttccactttaagttaactgaccaaaacaaggaccgatacgaagtgccccat
gaacatgtgcagcccttccaaggaagtgctgcttctcccttgacctatgacgtggaggtc
tccaagcagccatttagcatcaaagtgctcagaaggagcaacagtcgggtcctgtttgac
tcaagcatcgggcccctcctgtttgcggatcagttcctgcagctgtccacccgactgccc
agtgctaacgtgtacggcctgggagagcacgtgcaccagcagtaccgccatgatatgaac
tggaggacctggcccatatttgccagggacacagcccccactggggatggaactaacttg
tatggtgcacagacattcttcctgtgccttgaagatgctagtggattgtcctttggagtg
tttctgatgaacagcaatgccatggaggtcgccctccagcctaccccagctctcacttac
cgtaccattgggggcattctcgacttctatgtgttcttgggaagcactccagagcaagtt
gtccaggagtacctagagctcattggacggccagccctcccctcatactgggcacttggg
tttcatctcagtcgttatgattatgggaccctagataacatgaaagaagtcgtggacaga
aaccgtgcagcgcagctcccttacgatgttcagcatgctgatattgactacatggatgcg
aggaaggacttcacttatgacccagtaaattttaagggcttccctgagtttgcgaaggag
ttacacagtaatggacagaaactggtcatcattgtggatccagccatctccaacaactct
tccctaagcagtccctatggcccatatgacaggggttccgatgtgaagatctgggtgaat
gcatcagatggagtcactccactcattggggaggtctggcctggaaaaactgtgtttcct
gatttcactaatccccagtgtactgcttggtggacaaatgaatttgagcttttccacaat
caagtggagtttaatggaatctggattgatatgaatgaagttgccaacttcgttgatggt
tcggtttcaggatgctccacaagcaatctaaattatccccctttcactcccagagtcctg
gatgggtacctgttccgcaagagcctctgcatggatgcagtgcagcactggggcaagcat
tacgatgtccacagtctgtatggctactccatggccattgccaccgcagaagctgtcaag
actgtgttccctaacaagagaagcttcattttaacccgttctacctttgcggggtctggc
aagtttgcagcccactggttaggagacaacgcggccacctggagcgacctccagtggtcc
atccctgccatgctcgagttcaacctttttggtatcccaatggtgggttctgacatatgt
ggctttacactggatgctcctgaagagctctgcaggaggtggatgcagctgggagcattt
tatccattttccaggaatcacaattgccaaggctacaaggcccaggaccctgcctccttt
ggagctgattctctgctgctgaattcctccaggcactaccttactgtccgctacaccctg
ctgccccacctctacaccctcttctaccaggcccacagccggggggacacggtggccagg
ccccttctgcacgagttctatgcggacagcaacacgtgggatgtgcaccagcagtttctc
tgggggcccagcctgctcatcactccagttctcaatgagggagcagagaaagtgacagcg
tatgtgcctgacgccgtctggtatgactacgagactggggcccgcgtgagatggaggaag
cagagagtggagatggaacttcctggagacaaaatcgggcttcaccttcgaggtggctat
atcttccccacacaacagccggccacaaccacggaggccagtcgaaggaaccctcttggt
cttatcattgccctagatgagaacaaagaagcaaaaggcgaacttttctgggatgatggg
gaaacgaaagatactgtggccaataaagcttatctcttatgtgagttttccgtcacccaa
aaccgcttggatgtgaaaattctgcagtcaacctacacagaccccaataatttagtattt
aaagagattaaaatccttgggacccaggaacctaccaacattacagtgaaacacaatggt
gtccacccaagtcatgtttctcctaatgtcacttatgattctgacctacaggtggccctc
atcacaggaattgaccttgtcctgggagaagcatacacggtggagtgggatgtgaagata
agggatgcagaaaaaatagactgttaccctgatgagaatggtgcttctgcggaaaactgt
gctgcccgcggctgtgtctgggaggaatccagttctcctggagtccctttctgctatttc
atcaatgatctgtactctgttggtgatattcagtatgactcccatggggccacagctgtc
atctccttgaagtcttccccttatgcctacacattgccctcgacacctgtgagctccctc
cgtctggatgtgacctaccataaggataacatgctgcagtttaagatttatgatcccgac
aacaaccggtatgaagtcccaatccctctcaacatccccgaggttccatccagcacccct
gagagtcgactctatgaggtcctcattaagaagaacccatttgggattgaagttcgtcgg
aagagtacgggcactgtaatctgggactctcagctccttggcttcacgttcaacgacatg
ttcatccgcatctccacgcgcctcccctcccagtacctctatggctttggggaaaccgag
cacacggcctttcgaagagacttgaactggaacacgtggggcatgttttccagagaccag
cccccagggtacaagaagaattcctacggtgtccacccctactacatggcactggaggag
gacggcagtgcccacggagtgctcctgctaaacagcaatgccatggatgtgacattccag
cccttgcctgctttgacgtaccgtaccacaggaggagttctggacttctatgtggtgttg
gggccaactccagagcttgtcacccagcagtacactgagttgattggtcggccagtgatg
gttccttactggtccttggggtttcagctgtgtcgctatggataccagaacgactctgag
attgccagcttgtatgatgacatggtggctgcccagatcccctatgatgtgcagtacgcc
gacatcgactacatggagcggcagctggacttcaccctcggccccgaatttgctgggctc
ccagctctgattacacgcatccaggctgacgggatgcgggtcatcctcatcctggaccca
gccatctctggcaacgagacaaagccctatcctgccttcacgcggggtgtggaggaagat
gtcttcatcaaagacccaagcgatggaagcattgtctggggaaaggtctggcctgatttt
cctaatgttgttgtaaactcgtctctagactgggacactcagctggagctataccgagct
tatgtggccttcccggactttctccgtaattcaactatcacgtggtggaagagggagttg
agagaactctacaccaatccacggaatccagagacgagcttgaagtttgatggcatgtgg
attgacatgaatgagccggccagctttgtgaatggggcggttcccccaggctgcaagaac
gccactctgaaccacccgccctacatgccgcatttggagtccagggacaagggcctgagc
agcaagaccctgtgcatggagagccagcagatcctgcctgacggctccccggtgcggcac
tacgacgtgcacagcctgtacggctgggcgcagaccagacccacgtacgaagctgtgcag
gaggtgacgggagagcgaggcattgtcgtcactcgctccactttcccctcttctggccgc
tggggaggacactggctgggagacaacacggccgcgtgggaccagctgaggaaatctatc
attggcatgatggagttcagcctctttggcataccctatacaggagcagatatttgcggg
ttctttcaagatgccgaatatgaaatgtgtgctcgctggatgcagctgggggccttctac
ccctattcaaggaaccataacaccattgggaccaggaggcaagaccctgtgtcctggaat
gctacctttgtgactctgtccagaagcgtcctgcggaccagatacaccctgttgccttat
ctctacaccctgatgcacgtggcccacgtggagggcagcaccgtcgtgcggcctcttctc
catgagtttgtggcagaccgggtgacctgggatgtagacggtcagttcctgctgggccca
gccttcctggtcagccctgtcctgcagcctggtgccgcagacgtcactgcatacttcccc
agagcccgctggtatgattactacacgggtgtggacattaaagcccggggagagtggaag
tccttgccagcccctctcgaccacattaatcttcatgtccgtgggggctacatcctgccc
tggcaagagcctgcacagaacacccacttaagccgtcagaagttcctaggcttcaaggtc
gccctggatgatcaggggacggccgaaggttgtctattctgggatgacggacaaagcatc
gatacctatgaaaaaggactctattacctggccaacttttctgtcagccagaatacgatg
cagagccatgtaattttcaacaaatacatcagcgatacaaaccctttgaaactgggctac
gttgaaatctggggagtgggcagcaattccatttccagtgtcagcatttctgtgagcggc
gtggttgtgacccccagcttcacctatgactctacaacacaggtgttaaacattgatgtg
accagcagaaacatcagcctgcataatttcacctccttgacatggagaagcactctgagt
tcctag

DBGET integrated database retrieval system