KEGG   Camelus ferus (Wild Bactrian camel): 102514818Help
Entry
102514818         CDS       T02979                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00052  Galactose metabolism
cfr00500  Starch and sucrose metabolism
cfr01100  Metabolic pathways
cfr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102514818 (MGAM2)
   00500 Starch and sucrose metabolism
    102514818 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102514818 (MGAM2)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102514818 (MGAM2)
    3.2.1.20  alpha-glucosidase
     102514818 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110 Trefoil GHL15
Motif
Other DBs
NCBI-GeneID: 102514818
NCBI-ProteinID: XP_014415364
LinkDB All DBs
Position
Un
AA seq 2045 aa AA seqDB search
MEVINKPFSIKIMRTSNKRVLLDTGIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQEYRR
SVAWKTWPIFTRDATPTEGMINLYGAHTFFLCLEDTSGSSFGVFLMNSNAMEVTLQPAPA
ITYRTIGGILDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRNYGGIDGLKKV
VDRNRAAEIPYDVQYSDIDYMDGKKDFTIDKVAYPGLSDFAEELHKYGLKYVIIMNPGIL
NNSDYQPYMKGREKKVWILGNKGAVVGQGYPGWTVFPDFSNPDCTEWWGEQLSEFHKTLE
FDGVWIDMDEVSSFVQSSDHECEKNNLNFPPFTPRVLDRLLFARTLCMDTEFHWGLHYDV
HSLYGYSMARGTDSAMEKIFPSKRSFILSRSTFAGSGKFAGHWLGDNAATWNDLRWSIPG
ILEFSLFGIPMVGANICGYTENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSES
NSTLLDSSRHYLGIRYTLLPYLYTLFYRAHTQGETVARPLVHEFYQDPATWEVHEQFLWG
PGLLITPVLYEGPGPVKAYIPDATWYDYETREAIQWRKQFVEMLLPDDRIGLHLRGGYIF
PTQQPNTTTEVSRKNSLGLIIALDYKREAKGELYWDDGVSKDAVTKKNYTLYDFSVTSNR
LQAKIINDIYMDPNNLKFTDIIILGMDKQPTDFIVFHNNAATSISNVVYSNSTKVVSITD
LEGLVLGQEFSIEWKLPVSDLEKFDCYPEEPAVSEERCRQRGCLWEPTTVPGVPTCHYDT
IPNYAASNIQYLPTGITTDLSLLTAPEAAPAAASDPLSAEISFLRLSVTYHTENTLQFKI
YDPNNKRYEVPVPLNTPPSPVGSPENCLYDVSIQSNPFGIQIRRKSSGTVVWDSQLPGFT
FNDMFLSISTRLPSKNIYGFGETEHTTFRRNISWNTWGMFARDEPPAYKKNSYGVHPYYM
ALEEDGSAHGVLLLNSNAMDVAFQPTPALTYRTTGGILDFYMFLGPTPELVTQQYTELIG
RPAMIPYWALGFQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMDRKLDFTLSSS
FQNLGLLIEQMKKNGMRFILILDPAISGNETQYPPFTRGQENNVFIKWPDNSDIVWGKVW
PDLPNVNVSGSLDQETQVKLYRAHVAFPDFLRNSTAAWWKKEIGELYVNPREPEKSLKFD
GLWLDMNEPSNFVNGSVSGCRDETLNNPPYMPHLESRDRGLSSKTLCMESQQILPDGSPV
RHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNMAAWDQLRK
SIIGMMEFSLFGIPYTGADICGFFGEAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVA
WNSTFEMFSRKALQTRYTLLPYLYTLMHKAHVEGTTVVRPLLHEFTKDDTTWDIDRQFML
GPAILISPVLESNTFQIRAYFPRARWYDYSTESGSESTGEWKILEAPLDHINLHIRGGYI
LPWQEPAMNTQSSRQQFMGLIVALDTNGRAEGQLFWDDGQSIDTYENGNYFLANFTAAQN
VLQIQTIHNKYLSDSNPLKVGSISIWGINSTHVTQVTCTYDNQQFMVMDFKSDPYNQTLT
VQLTDKIISLEKLTEVTWIHGDPTVSTTPMTSTLPMTSSHPSTSTTKATTADTVTTGAAT
SSTTTASTSATLPVTTTFYPTSATQATTATTIYNATTPSSTNTTTGSPNVTHPATTVPFS
TTTTEFTTATTIYNTTTPSPPSTPPSSPNVTLPATTVPFLTTTTEFTTAATIYNTTTPSP
PSTPPSSPNVPHPATTMPFSTTTTEFTTATTIYNATTPSSTNTTTGGPNVTLPATTVPFL
TTTTEFTTAATIYNTTTPSPPSTPPSSPNVTLPATAVPFSTTTTEFTTAATIYNTTTPSP
PSTPPSSPNVTLPATTVPFSTNATEITTSTTIYNTTTPSPTSTPPSSPNVTLPATAMPFS
TTTTEFTTAATIYTTTPSPTNATSDSTNVSLPVTTVPSLTGATEFTTDATIPNATTPSPT
NTTAA
NT seq 6138 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcattaataagcccttcagcatcaaaataatgaggacgagcaacaaaagagtc
ttgttggacacgggcatcgggcccctccagttcgcccagcagtacctgcagctgtctttc
cgactgcccagcgccaacgtgtatgggctgggagagcacgtgcaccaggagtaccgccgc
agcgtggcctggaagacctggcccatcttcacccgcgatgccacccccaccgagggcatg
attaatctgtatggagctcataccttcttcttgtgccttgaagacaccagcggctcctct
ttcggggtttttctgatgaacagtaatgccatggaggtcacccttcagccggctcctgcg
atcacttaccgcaccattgggggcattcttgacttctacgtgttcctgggaaatactcca
gaacaagtggttcaggaatacctggagcttgttggacgaccattcttgcctccctactgg
agtcttgggttccagcttagtcgcaggaattatggtggcatcgacggattgaaaaaagtt
gtagaccgaaatcgtgcagctgagattccatatgatgtccagtactctgacatagactac
atggatggaaagaaggacttcaccattgataaggtggcgtaccctggtctctcagatttt
gccgaagagttacataaatatggactgaaatatgtaattattatgaatcctggcatctta
aataactctgactaccagccttatatgaagggaagagaaaagaaagtgtggatcttaggg
aacaaaggcgctgttgttgggcagggttatcctggatggacagtctttcctgattttagt
aacccagattgtactgagtggtggggagagcagctcagtgaatttcataaaactctggag
tttgatggcgtgtggattgacatggatgaagtatcgagctttgtccaaagttctgatcac
gagtgtgaaaagaacaacttaaactttcctcctttcactcctcgagtcctggaccgcttg
ctttttgcaagaactctctgcatggacacagagtttcactggggcctccactacgatgtg
cacagcctgtatggctactccatggccagaggcacagactcggccatggagaaaatcttc
cccagtaaaagaagcttcatcttatcccgttctactttcgctggatctggcaaatttgct
ggtcattggttgggggacaatgcggccacgtggaatgatctccgatggtccatccctggt
atccttgagttcagcctcttcggcattcccatggtaggtgccaacatctgcggttataca
gaaaatgtcacggaggaactctgcagaaggtggatgcagcttggagcattttacccacta
tcaagaaatcacaatgggcctgggttcagggaccaggatcctgctgcctttagtgaaagc
aactcgacgctgctggattcctccaggcactacctgggcatccgctacaccctgctgccc
tacctctacaccctcttctaccgagctcacacccagggggagacggtggcaaggcccctc
gtccacgagttctaccaggacccagccacgtgggaggtgcacgagcagtttctgtggggg
cctggactcctcatcacgcctgtgttatacgaaggtccggggcccgtgaaagcgtacata
ccagacgccacctggtacgactatgagacaagagaagccatccagtggaggaaacaattt
gtggagatgctactgccggatgataggataggacttcacctgcgagggggctacatcttt
cccacccagcagccaaacacaaccacagaggtcagtcggaagaattccctgggactcatt
attgccttggactataaaagagaagccaagggagagttgtactgggatgacggtgtatct
aaagacgctgtaactaaaaagaattatactctgtatgatttttctgtcacctctaaccgt
ctacaggcaaagattataaatgatatttatatggaccccaacaacctgaaatttacagat
attataatcttgggaatggacaagcaacctactgactttatcgtcttccataataatgcc
gccacctccatttcaaatgttgtctacagtaattcaacaaaggtggtgagcatcaccgat
cttgagggactggtactaggacaagaattctccattgagtggaagcttcctgttagtgac
ctggagaagttcgactgctaccctgaggagcctgctgtctccgaggagaggtgcaggcaa
cggggatgcctttgggagcccacaactgtccctggcgtgcccacctgtcactatgacacc
atccctaattatgctgccagtaacattcagtacctgcctacgggcatcaccacagacctt
tccctcctaacggctcctgaagcagcaccagccgccgcctctgatcctctctctgcagag
atcagctttctccgcctgagtgtgacctaccacacagaaaacacgctgcagttcaagatc
tatgatcccaataataaaaggtacgaggtccccgtgcctctgaacacccctccctctcca
gtcggctcccctgaaaactgtctgtatgatgtcagcattcaaagcaatcctttcgggatc
cagattcgacgaaaaagctccggcactgtggtctgggactcccagctccccggcttcacc
ttcaacgacatgttcctttccatctccacgcgcctcccctctaagaacatctatggcttt
ggggaaaccgaacacacaactttcaggagaaacatcagctggaacacgtgggggatgttt
gctcgagatgagccaccagcgtacaagaagaattcctacggtgtccacccctactacatg
gcactggaggaggacggcagtgcccacggagtgctcctgctaaacagcaatgccatggat
gtggcattccagcccactcctgccctgacataccgcaccacaggaggaattttggacttc
tatatgtttttagggccaactcctgaacttgtaactcagcaatacactgagttgattggt
cggccagcaatgattccgtactgggccttgggattccagctgagtcgctatggataccag
aatgatgccgaaatctccagtttgtatgacgccatggtggcagctcagattccctacgac
gtccagcatgtagacatcgattacatggaccggaagctggacttcaccctcagctccagc
tttcaaaatctcggcctcctgattgagcaaatgaagaaaaatggcatgagatttattctc
attctggacccagccatttctggcaacgagacccagtaccccccattcaccagggggcag
gagaacaacgtgttcatcaaatggccagacaacagtgacattgtctggggaaaggtttgg
ccagatctgcccaatgtgaatgtgagtggatcccttgaccaagaaactcaagttaagctg
tacagagcccacgtggcttttcctgacttcttgcggaacagcacggctgcgtggtggaag
aaggagataggggagctctacgtgaacccccgagagccggagaagagcttgaagtttgac
ggactgtggcttgatatgaacgaaccatcaaactttgtgaatggctctgtcagcggctgc
agggatgagactctcaataaccctccctatatgccacatttggagtccagggacaggggc
ctgagcagcaagaccctgtgcatggagagccagcagatcctgcctgacggctccccggtg
cggcactacgacgtgcacagcctgtacggctgggcccagaccagacccacatacgaagct
gtgcaggaggtgacaggacagcgagggatcgtcatcactcgctccacattcccctcttct
ggacgctggggaggacactggctgggagacaacatggccgcgtgggaccagctgaggaaa
tctatcattggcatgatggagttcagtctctttggaataccttatacaggagcagacatt
tgcggcttctttggagaggctgaatatgagatgtgtgttcgctggatgcagctgggggcg
ttttatccattctccaggaaccacaacacgttcgggacaaggagacaagatcctgtggcc
tggaactcaacctttgagatgttctcaagaaaagccctccagaccagatacaccctgctg
ccttacctctatactctgatgcataaggctcacgttgagggcaccaccgtagtccgaccc
cttctccatgagtttacaaaggatgacacaacatgggatatagaccgtcagttcatgctg
ggtcctgccatcttaatcagccccgtgctggaaagtaacacttttcagatccgtgcttat
tttcccagagcccgttggtatgactatagcacggaatctggcagtgaatcgacaggtgag
tggaaaatcctggaggctccccttgaccatatcaacctgcatatccgaggaggctacatc
ctgccttggcaggagcctgcaatgaacactcagtccagtcgacaacagtttatgggattg
attgtcgctttggacaccaatgggagagctgaaggtcagctgttctgggatgatggacaa
agcattgacacctatgaaaatggaaactacttcttggcaaactttacagcagctcagaat
gtattgcaaatccagaccatacacaataagtatttgagtgactctaatccactgaaagtt
ggaagtattagtatctggggcataaattctacacatgtaacacaagtcacttgtacctat
gacaaccagcaattcatggtgatggatttcaagagtgacccttataatcagacactaact
gttcaattgacagacaagattatcagcctggaaaaattaacggaggttacttggattcat
ggtgatcctacagtttctaccacacctatgacaagtaccttgccaatgacttcttctcat
ccgtctacatctactacgaaggctaccactgctgatactgttaccaccggtgctgctaca
tccagtaccacgactgccagcactagcgccactcttcctgtcaccaccacgttttaccca
acaagtgctactcaagctacaactgctactaccatttataacgccactacgccttcctct
acaaatactactactggtagccccaatgttacccatcctgccacaactgtgcctttctca
acaactaccactgaatttacaactgctactaccatttataataccactacgccttcccct
ccaagtactcctcctagtagccctaatgttacccttcctgccacaactgtgcctttctta
acaactaccactgaattcacaactgctgctaccatttataataccactacgccttcccct
ccaagtactcctcctagtagccctaatgttccccaccctgccacaaccatgcctttctca
acaactaccactgaatttacaactgctactaccatttataacgccactacgccttcctct
acaaatactactactggtggccctaatgttacccttcctgccacaactgtgcctttctta
acaactaccactgaattcacaactgctgctaccatttataataccactacgccttcccct
ccaagtactcctcctagtagccctaatgttacccttcctgccacagccgtgcctttctca
acaactaccactgaattcacaactgctgctaccatttataataccactacgccttcccct
ccaagtactcctcctagtagccctaatgttacccttcctgccacaaccgtgcctttctca
acaaatgccactgaaattacaactagtactaccatctataataccactacgccttcccct
accagtactcctcctagtagccctaatgttacccttcctgccacagccatgcctttctca
acaactaccactgaattcacaactgctgctaccatttataccactacaccttcccctaca
aatgctacttctgacagcactaatgtgtctcttcctgtcacaaccgtgccttccctgaca
ggtgctactgaatttacaactgatgctactattcctaatgccactacaccttcccctaca
aatactactgctgcctaa

DBGET integrated database retrieval system