KEGG   Camelus ferus (Wild Bactrian camel): 102514843
Entry
102514843         CDS       T02979                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr04010  MAPK signaling pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04020  Calcium signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04370  VEGF signaling pathway
cfr04510  Focal adhesion
cfr04926  Relaxin signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05200  Pathways in cancer
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05219  Bladder cancer
cfr05323  Rheumatoid arthritis
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102514843 (VEGFA)
   04014 Ras signaling pathway
    102514843 (VEGFA)
   04015 Rap1 signaling pathway
    102514843 (VEGFA)
   04370 VEGF signaling pathway
    102514843 (VEGFA)
   04066 HIF-1 signaling pathway
    102514843 (VEGFA)
   04020 Calcium signaling pathway
    102514843 (VEGFA)
   04151 PI3K-Akt signaling pathway
    102514843 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102514843 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102514843 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102514843 (VEGFA)
   05206 MicroRNAs in cancer
    102514843 (VEGFA)
   05205 Proteoglycans in cancer
    102514843 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102514843 (VEGFA)
   05211 Renal cell carcinoma
    102514843 (VEGFA)
   05219 Bladder cancer
    102514843 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102514843 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102514843 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102514843 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102514843 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102514843 (VEGFA)
   05165 Human papillomavirus infection
    102514843 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102514843 (VEGFA)
Cytokines and growth factors [BR:cfr04052]
 Growth factors
  Growth factors (RTK binding)
   102514843 (VEGFA)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102514843 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 102514843
NCBI-ProteinID: XP_032319413
LinkDB
Position
20
AA seq 635 aa
MDPSHSSPLGASHSDVSRPDEGYRGTHCPDEYIVPPMPSTGLCAYEAIRVPNMPLFGRSE
MGGSGSAGSGEERRGLGQPGCEEAAARVVSGAGGSCTRSGETHRRGGRTGGVTSHGSPHW
NLIFIYPGFTLLLFPETFLKTVFFPVLIYFGFPFPAKSGRPFGEIAPVLPQITSDFGNQQ
REERGSKSSKEKSRKRDWVRERARASEKREDRGKVSDLLLGVTARARREPSPSGSRVGPA
ALTDRQTDTAPRPSAHLLPGRRPTVDAAASRGQEPEPAPGGGVEGVGARGVALKLFIQLL
GCSRSGGAVVRLGAADPSETGRSASSVREEPQSAEGEEEEEKEEERGPRWRLGSRKPGSW
TGEAAVCADSAPAARAPQALARALAPGGRGARLGAEESGRPRSPSQRGSASRASPGRASE
TMNFLLSWVHWSLALLLYLHHAKWSQAAPMTAGEQKPHEVVKFMDVYQRSYCRPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggaccccagtcactccagccctttgggtgcatctcactctgatgtcagcaggcctgat
gagggctatagagggacacattgtccagatgaatacatcgtgccccctatgcccagcact
gggctctgtgcatatgaggccattcgagtcccaaacatgccactgtttgggaggtcagaa
atggggggatcagggtcggctggtagcggtgaagagcgcagaggcttggggcagccgggc
tgcgaggaggccgcggcgcgggtggtgagtggagccggcggcagctgcactcggtccgga
gagacgcatcggcgagggggacgaaccggcggggtcaccagccacgggtctccgcactgg
aatttgatattcatttacccagggtttaccctcctcctttttcccgaaacatttttaaaa
acagtattctttcccgttttaatttattttggcttcccattccccgctaaatccggccga
ccgtttggggagattgctcctgtactcccccaaatcacttcggattttggaaatcagcag
agagaagaaagaggtagcaagagctccaaagagaagtcgaggaagagagactgggtcaga
gagcgcgcgcgggcaagcgagaaacgagaggacaggggcaaagtgagtgacctgcttttg
ggggtgaccgccagagcgcggcgtgagccctccccctcgggatcccgcgtcggaccagca
gcgctgacggacagacagacagacaccgccccccgccccagcgcccacctcctccccggc
cggcggccgacggtggacgcggccgcgagccgcgggcaggagccggagcccgcgcccgga
ggcggggtggagggggtcggggctcgcggtgttgcactgaaacttttcatccaacttctg
ggctgttctcgctccggaggagccgtggtccgcctcggggcagcagatccgagcgaaacc
gggagaagtgctagctccgttcgggaggagccgcagtcggcggagggggaggaggaagaa
gagaaggaagaggagagggggccgcggtggcgactcggctctcggaagccgggctcatgg
acgggtgaggcggctgtgtgcgcagacagtgctccagccgcgcgcgcgccccaggccctg
gcccgggccttggctccgggaggaagaggagcccgcctaggcgctgaggagagcgggcgg
ccccgcagcccgagccagagagggagcgctagccgcgccagccccggccgggcctccgaa
accatgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccac
catgccaagtggtcccaggctgcacccatgacagcaggagagcagaaacctcatgaagtg
gtgaagttcatggacgtctaccagcgcagctactgccgtccaatcgagaccctggtagac
atcttccaggagtaccctgatgagatcgagtacatctttaagccgtcctgtgtgcccctg
atgaggtgcgggggctgctgcaatgatgaaggtctggagtgtgtgcccaccgaggagttc
aacatcaccatgcagattatgcggattaaacctcaccaaggccaacatataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagacagagcaaggcaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccggtat
aaatcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system