KEGG   Camelus ferus (Wild Bactrian camel): 102514894
Entry
102514894         CDS       T02979                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04061  Viral protein interaction with cytokine and cytokine receptor
cfr04151  PI3K-Akt signaling pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  Jak-STAT signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04660  T cell receptor signaling pathway
cfr04672  Intestinal immune network for IgA production
cfr04940  Type I diabetes mellitus
cfr05135  Yersinia infection
cfr05142  Chagas disease (American trypanosomiasis)
cfr05162  Measles
cfr05166  Human T-cell leukemia virus 1 infection
cfr05200  Pathways in cancer
cfr05320  Autoimmune thyroid disease
cfr05321  Inflammatory bowel disease (IBD)
cfr05330  Allograft rejection
cfr05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102514894 (IL2)
   04151 PI3K-Akt signaling pathway
    102514894 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102514894 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102514894 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102514894 (IL2)
   04660 T cell receptor signaling pathway
    102514894 (IL2)
   04658 Th1 and Th2 cell differentiation
    102514894 (IL2)
   04659 Th17 cell differentiation
    102514894 (IL2)
   04672 Intestinal immune network for IgA production
    102514894 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102514894 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102514894 (IL2)
   05321 Inflammatory bowel disease (IBD)
    102514894 (IL2)
   05330 Allograft rejection
    102514894 (IL2)
   05332 Graft-versus-host disease
    102514894 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102514894 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102514894 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102514894 (IL2)
   05162 Measles
    102514894 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    102514894 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102514894 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:cfr00536]
    102514894 (IL2)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Interleukins
   102514894 (IL2)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate / Haparin
  Cytokines
   102514894 (IL2)
SSDB
Motif
Pfam: IL2 Baculo_PEP_C Snapin_Pallidin
Other DBs
NCBI-GeneID: 102514894
NCBI-ProteinID: XP_006180770
LinkDB
Position
2
AA seq 154 aa
MYKLQFLSCIALTLALVANSAPTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRML
TFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGS
ETGFTCEYDDETVTVVEFLNKWITFCQSIYSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagctgcaattcttgtcttgcattgcactaactcttgcactcgtagcaaacagt
gcacctactttgagctctacgaaggacacaaagaaacaactggagccactgttgctggat
ttacagtttcttttgaaggaagttaataactatgagaacctcaaactctccaggatgctc
acatttaaattttacatgcccaagaaggctacagaattgaaacaccttcagtgtctcatg
gaagaactcaaacctttggaggaagtgctaaatttagctcaaagcaaaaactctcacctg
acaaatatcaaggactcaatgaacaatatcaatttaacggtttcggaactgaagggatct
gaaacaggattcacatgtgaatatgatgatgagacagtaactgttgtagaatttctgaac
aaatggattaccttttgccaaagtatctactcaacactgacttga

DBGET integrated database retrieval system