KEGG   Camelus ferus (Wild Bactrian camel): 102515320
Entry
102515320         CDS       T02979                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01523  Antifolate resistance
cfr04060  Cytokine-cytokine receptor interaction
cfr04061  Viral protein interaction with cytokine and cytokine receptor
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04218  Cellular senescence
cfr04620  Toll-like receptor signaling pathway
cfr04621  NOD-like receptor signaling pathway
cfr04623  Cytosolic DNA-sensing pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04640  Hematopoietic cell lineage
cfr04657  IL-17 signaling pathway
cfr04659  Th17 cell differentiation
cfr04668  TNF signaling pathway
cfr04672  Intestinal immune network for IgA production
cfr04931  Insulin resistance
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05010  Alzheimer disease
cfr05020  Prion disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05132  Salmonella infection
cfr05133  Pertussis
cfr05134  Legionellosis
cfr05135  Yersinia infection
cfr05142  Chagas disease
cfr05143  African trypanosomiasis
cfr05144  Malaria
cfr05146  Amoebiasis
cfr05152  Tuberculosis
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05321  Inflammatory bowel disease
cfr05323  Rheumatoid arthritis
cfr05332  Graft-versus-host disease
cfr05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102515320 (IL6)
   04668 TNF signaling pathway
    102515320 (IL6)
   04066 HIF-1 signaling pathway
    102515320 (IL6)
   04068 FoxO signaling pathway
    102515320 (IL6)
   04151 PI3K-Akt signaling pathway
    102515320 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102515320 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102515320 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102515320 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102515320 (IL6)
   04620 Toll-like receptor signaling pathway
    102515320 (IL6)
   04621 NOD-like receptor signaling pathway
    102515320 (IL6)
   04623 Cytosolic DNA-sensing pathway
    102515320 (IL6)
   04625 C-type lectin receptor signaling pathway
    102515320 (IL6)
   04659 Th17 cell differentiation
    102515320 (IL6)
   04657 IL-17 signaling pathway
    102515320 (IL6)
   04672 Intestinal immune network for IgA production
    102515320 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102515320 (IL6)
   05202 Transcriptional misregulation in cancer
    102515320 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102515320 (IL6)
   05321 Inflammatory bowel disease
    102515320 (IL6)
   05332 Graft-versus-host disease
    102515320 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102515320 (IL6)
   05020 Prion disease
    102515320 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    102515320 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102515320 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102515320 (IL6)
   04931 Insulin resistance
    102515320 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102515320 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102515320 (IL6)
   05135 Yersinia infection
    102515320 (IL6)
   05133 Pertussis
    102515320 (IL6)
   05134 Legionellosis
    102515320 (IL6)
   05152 Tuberculosis
    102515320 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102515320 (IL6)
   05161 Hepatitis B
    102515320 (IL6)
   05171 Coronavirus disease - COVID-19
    102515320 (IL6)
   05164 Influenza A
    102515320 (IL6)
   05162 Measles
    102515320 (IL6)
   05168 Herpes simplex virus 1 infection
    102515320 (IL6)
   05163 Human cytomegalovirus infection
    102515320 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102515320 (IL6)
   05169 Epstein-Barr virus infection
    102515320 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102515320 (IL6)
   05144 Malaria
    102515320 (IL6)
   05142 Chagas disease
    102515320 (IL6)
   05143 African trypanosomiasis
    102515320 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102515320 (IL6)
   01523 Antifolate resistance
    102515320 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102515320 (IL6)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Interleukins
   102515320 (IL6)
SSDB
Motif
Pfam: IL6 IL23 GCSF Sec16 FtsH_ext
Other DBs
NCBI-GeneID: 102515320
NCBI-ProteinID: XP_006179266
LinkDB
Position
7
AA seq 240 aa
MRLGMPEAQSALEPTRNERELHLPSRNSAMNSLSTSAFSPVAFSLGLLLVMATAFPTPVP
LGEDFKDGTTSNRPFTSPDKSEELIKYILGRISAMRKEMCEKYDKCENSKEALSENNLNL
PKMTEKDGCFQSGFNQETCLMRITIGLLEFQIYLDYLQNYYEGDKGNTEAVQISTKALIQ
LLRQKVKQPEEVSTPNPITGSSLLNKLQTENQWMKNTKMILILRSLEDFLQFSLRAVRIM
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagactggggatgcctgaggctcagtctgccctcgagcccaccaggaacgaaagagag
ctccatctgccctccaggaactcagctatgaactcgctctccacaagcgccttcagtcca
gttgccttctccctggggctgctcctggtgatggctactgctttccctaccccggtaccc
ctgggagaagatttcaaagatggtaccacctcaaacagaccattcacctctccagacaaa
tctgaagaactcattaagtacatcctcggcagaatctctgcaatgagaaaggagatgtgt
gaaaagtatgacaagtgtgaaaacagcaaggaggcactgtcagaaaacaacttgaacctt
ccgaaaatgacagaaaaagacggatgcttccaatctgggttcaatcaggagacctgcctg
atgagaatcaccattggtcttctggagtttcagatatacctggactacctccagaactat
tatgagggtgataagggaaacactgaggctgtgcaaatcagtaccaaagcactgatccag
ctcctgaggcaaaaagtaaagcaaccagaagaagtaagcacccctaacccaatcacaggc
tccagcctgctgaataaactgcagaccgagaaccagtggatgaagaatacaaaaatgatc
ctcatcctgcgaagcctcgaggatttcctgcaattcagcctgagggctgttcggataatg
tag

DBGET integrated database retrieval system