KEGG   Camelus ferus (Wild Bactrian camel): 102515362
Entry
102515362         CDS       T02979                                 

Gene name
STK11
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase STK11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04068  FoxO signaling pathway
cfr04140  Autophagy - animal
cfr04150  mTOR signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04211  Longevity regulating pathway
cfr04530  Tight junction
cfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102515362 (STK11)
   04151 PI3K-Akt signaling pathway
    102515362 (STK11)
   04152 AMPK signaling pathway
    102515362 (STK11)
   04150 mTOR signaling pathway
    102515362 (STK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102515362 (STK11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102515362 (STK11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102515362 (STK11)
  09149 Aging
   04211 Longevity regulating pathway
    102515362 (STK11)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102515362 (STK11)
Protein kinases [BR:cfr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102515362 (STK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH Pkinase_fungal
Other DBs
NCBI-GeneID: 102515362
NCBI-ProteinID: XP_006173331
LinkDB
Position
22
AA seq 438 aa
MDVADPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVSQAHGYFCQLVDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGDYTIPGDCGPPLSDLLKGMLEYEPAKRFSI
QQIRQHSWFRKKHPPAEELVPIPPSADCKDRWRGMTVVPYLEDLHGCADDVDEELLDIED
DIIYTQDFTVPGQVPDEETSQSGQKRGLPKALCVNGTESAQLSTKSRVERRASATSNPAR
KACSASSKIRRLSACKQQ
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggatgtggcggacccgcagcagctgggcatgtttacagagggcgagctgatgtcggtg
gggatggacacgtttattcaccgcatcgactctaccgaggtcatctaccagccccgccgc
aagcgggccaaactcatcggcaagtacctgatgggggacctgctgggggagggttcgtac
ggcaaggtgaaggaggtgctggactcggagaccctgtgcaggagggctgtcaaaatcctc
aagaagaagaagttgcggaggatccccaacggggaagccaatgtgaaaaaggagatccag
ctcctgcggaggctgcggcacaagaacgtcatccaactggtggatgtgttgtacaacgaa
gagaagcagaagatgtatatggtgatggagtactgcgtgtgtggcatgcaagagatgctg
gacagcgtgcctgagaagcgcttccccgtgagccaggcccacgggtacttctgccagctg
gtggacggcctggagtacctgcacagccagggcatcgtgcacaaggacattaagcccggc
aacctgctgctcaccactggcggcactctcaagatctccgacctgggcgtggctgaggcc
ctgcacccgtttgccgaggatgacacgtgccggacaagccagggctcccccgcgttccag
ccgcctgagattgccaatggcttggacaccttctcgggcttcaaggtggacatctggtcg
gctggggtcacgctctacaacatcacgacaggcctgtacccgttcgagggggacaacatc
tacaagctgtttgagaacatcgggaagggggactacacgatccctggcgactgcggcccc
ccactctcggacctgctgaaagggatgctggaatacgagccggccaagaggttttccata
cagcagatcagacagcacagctggttccggaagaagcacccaccggccgaggagctggtg
cccatcccgccgagcgcagactgcaaggaccggtggcgtggcatgacggtggtgccatac
ctggaggacctgcacggctgtgccgacgacgtggacgaggagctcctcgacattgaggac
gacatcatctacactcaggacttcacggtgcccggacaggtcccagacgaggagaccagt
cagagcggacagaagaggggcttgcccaaggccttgtgtgtgaatggcacagaatcagcc
cagctgagcaccaaatccagggtggagcgccgggccagtgccacctccaaccccgcccgc
aaggcctgctcggccagcagcaagatccgccggctctcggcctgcaagcagcagtga

DBGET integrated database retrieval system