KEGG   Camelus ferus (Wild Bactrian camel): 102515500
Entry
102515500         CDS       T02979                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X2
  KO
K05430  interleukin 4
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04060  Cytokine-cytokine receptor interaction
cfr04151  PI3K-Akt signaling pathway
cfr04630  JAK-STAT signaling pathway
cfr04640  Hematopoietic cell lineage
cfr04657  IL-17 signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04660  T cell receptor signaling pathway
cfr04664  Fc epsilon RI signaling pathway
cfr04672  Intestinal immune network for IgA production
cfr05140  Leishmaniasis
cfr05200  Pathways in cancer
cfr05310  Asthma
cfr05320  Autoimmune thyroid disease
cfr05321  Inflammatory bowel disease
cfr05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102515500 (IL4)
   04151 PI3K-Akt signaling pathway
    102515500 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102515500 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102515500 (IL4)
   04660 T cell receptor signaling pathway
    102515500 (IL4)
   04658 Th1 and Th2 cell differentiation
    102515500 (IL4)
   04659 Th17 cell differentiation
    102515500 (IL4)
   04657 IL-17 signaling pathway
    102515500 (IL4)
   04664 Fc epsilon RI signaling pathway
    102515500 (IL4)
   04672 Intestinal immune network for IgA production
    102515500 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102515500 (IL4)
  09163 Immune disease
   05310 Asthma
    102515500 (IL4)
   05320 Autoimmune thyroid disease
    102515500 (IL4)
   05321 Inflammatory bowel disease
    102515500 (IL4)
   05330 Allograft rejection
    102515500 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102515500 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfr04052]
    102515500 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:cfr00536]
    102515500 (IL4)
Cytokines and growth factors [BR:cfr04052]
 Cytokines
  Interleukins
   102515500 (IL4)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate / Haparin
  Cytokines
   102515500 (IL4)
SSDB
Motif
Pfam: IL4 AAR2 DUF4942 DUF1732 SecIII_SopE_N
Other DBs
NCBI-GeneID: 102515500
NCBI-ProteinID: XP_006179658
LinkDB
Position
3
AA seq 133 aa
MGLTYQLIPTLVCLLVCTSNFAHGHKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAP
KNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLE
RLKKIMKEKYSKC
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggtctcacttaccaactgatcccaaccctggtctgcttactggtttgtaccagcaac
tttgcccacggacacaagtgtgatatcaccttgcaagagatcatcaaaacgctgaacacc
ctcactgcgagaaagaattcgtgcatggagctgactgtagcagacgtctttgctgcccca
aagaacacgactgagaaggaaaccttctgcaaggcggcaactgctcttcggcacatctac
agacaccacaactgcttgagcaaacacctgagcggacttgacaggaacctcagcggcctg
gcaaacacgacctgttctgtgaatgactccaagaagagcacattgagagacttcttggaa
aggctaaagaagattatgaaggagaaatactcaaaatgttga

DBGET integrated database retrieval system