KEGG   Camelus ferus (Wild Bactrian camel): 102515728
Entry
102515728         CDS       T02979                                 

Gene name
UPK3A
Definition
(RefSeq) uroplakin-3a
  KO
K19520  uroplakin-3a
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    102515728 (UPK3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfr04147]
    102515728 (UPK3A)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102515728 (UPK3A)
SSDB
Motif
Pfam: PTP_tm Uroplakin_II
Other DBs
NCBI-GeneID: 102515728
NCBI-ProteinID: XP_006176715
UniProt: S9X9F6
LinkDB
Position
12
AA seq 287 aa
MPPLWVLLALGCLRLGSSVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSVPLPGTYE
VYLYVLVDSASSRNASVQDSTMTPLSSTFQQTEGGRTGPYKAAAFDLTPCSDLPSLDAVG
DVSQASEILNAYLVRVGTNATCLFDPNFQGLCNPPLSAATEYRFKFVLVNMSTGLVQDQT
LWSDPIRTHRLIPYSSIDTWPGRRSGGMIVITSILGSLPFFLLVGFAGAIVLSLVDMGSA
EGETTHDSQITQEAVPKSLGTSEASYTSVNRGPPLDRAEVYTSKLQD
NT seq 864 nt   +upstreamnt  +downstreamnt
atgcctccgctctgggtcctgctggccctcggctgcctgagacttggctcgagtgtgaac
ctccagccccaactggctagtgtgacctttgccaccaacaatcccacgctcaccaccgtg
gccttggaaaagcctctctgcatgtttgacagctccgtgcccctccctggcacctacgag
gtctacctctatgtactggtcgactcagccagctccaggaatgcctctgtacaggacagc
accatgaccccactcagctcaacattccagcagacggagggaggaaggacaggtccctat
aaggccgcagcctttgacctgaccccatgcagtgacctgcccagcttggatgctgttggg
gatgtgtcccaggcctcggagatcctgaacgcctacctggtcagggtgggcaccaatgcg
acctgcctgtttgaccccaacttccagggcctctgcaacccacccctgtcagcagccacg
gaatacaggttcaagtttgtcctcgtcaatatgtccacgggcttggtccaggaccagacc
ctatggtcagaccccatccgcacccaccggctcatcccgtactcgtcgatcgacacgtgg
cccggccggcggagcgggggcatgatcgtcatcacatccatcctgggctccctgcccttc
ttcctgctcgtgggctttgctggcgccattgtcctcagcctcgtggacatgggcagtgct
gagggagaaaccacccacgactcccagatcacgcaggaggccgtccccaagtccctgggg
acctcagaggcttcgtacacgtctgtgaaccgggggccacccctggacagggccgaggtg
tacaccagcaagctccaggattga

DBGET integrated database retrieval system