KEGG   Camelus ferus (Wild Bactrian camel): 102516507Help
Entry
102516507         CDS       T02979                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00010  Glycolysis / Gluconeogenesis
cfr00030  Pentose phosphate pathway
cfr00051  Fructose and mannose metabolism
cfr00052  Galactose metabolism
cfr01100  Metabolic pathways
cfr01200  Carbon metabolism
cfr01230  Biosynthesis of amino acids
cfr03018  RNA degradation
cfr04152  AMPK signaling pathway
cfr05230  Central carbon metabolism in cancer
Module
cfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102516507 (PFKM)
   00030 Pentose phosphate pathway
    102516507 (PFKM)
   00051 Fructose and mannose metabolism
    102516507 (PFKM)
   00052 Galactose metabolism
    102516507 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102516507 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102516507 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102516507 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102516507 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cfr03019]
    102516507 (PFKM)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102516507 (PFKM)
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102516507 (PFKM)
Messenger RNA biogenesis [BR:cfr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102516507 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 102516507
NCBI-ProteinID: XP_006177719
LinkDB All DBs
Position
Un
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGVGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVD
GGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLNDLQKAGKITAEEAAKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPITSEEIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMNERRFDEAMKLRGRSFMNNWEVYKLLAHVRPPMSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKLYDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEDPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNDNYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALIF
QPVAELKEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaggagcaccatgcagccaaaaccctgggggtcggcaaagccatcgccgtg
ttaacctctggtggtgatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggaatctatactggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggagataacatcagggaagccacctgggagagcgtttcaatgatgcttcagctggga
ggcacagtgattggaagcgcccggtgcaaggactttcgggagcgagagggacggctccga
gctgcccacaacctggtgaagcgtgggattaccaacctgtgtgtcatcgggggtgacggt
agcctcactggggccgacaccttccgctctgagtggagcgacttgttgaatgacctccag
aaagcaggtaagatcacagcagaggaggctgcgaaatccagctacctgaacattgtgggc
ttggttggctcaattgacaacgacttctgtggcaccgatatgaccattggcactgactct
gccctgcaccggatcatagagatcgtagacgccatcactactaccgctcagagccaccag
aggacgtttgtgctagaagtgatgggccggcactgtggatacctggcccttgtcacctct
ctctcctgtggggccgactgggtttttattcccgagtgtccaccagatgatgactgggag
gaacacctttgtcgccggctcagcgagacaaggaaccgtggttctcgtctcaacatcatc
attgtggctgagggtgcgatcgacaaaaatggcaaaccaatcacgtcagaagaaataaaa
aacctggtggtaaagcgtctgggatatgacacccgggtcactgtcttgggacatgtgcag
cgaggtgggacaccgtcagcctttgacagaatcctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccggacaccccagcctgtgtggtgagcctctctggt
aaccaggctgtgcgcctgcccctcatggagtgtgtccaggtgaccaaagatgtgaccaag
gccatgaatgagaggcgattcgatgaagccatgaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctggctcatgtcagacccccaatgtccaagagtggctca
cacacagtggctgtgatgaacgtgggggccccggctgcaggcatgaatgccgccgtccgc
tccaccgtgagaattggcctgatccagggcaaccgagtgctggttgtgcatgatggcttc
gagggcctggccaagggtcagatcgaggaagctggctggagctacgttggaggctggact
ggccaaggtggttctaaacttgggactaaaaggactttacccaagaagagcttcgaacag
atcagtgccaacatcaccaagtttaacatccagggccttgtcatcattgggggctttgag
gcttacacggggggcctggagctgatggagggcaggaagctgtacgacgagctctgcatc
ccattcgtggtcattcctgctacggtctccaacaacgtgcctggctcagacttcagcgtg
ggggccgacacagccctcaacaccatctgcatgacctgtgaccgcatcaagcagtcagca
gcaggcaccaagcgccgggtgtttatcatcgagaccatgggcggctactgtggctacctg
gccaccatggctggactggcagctggggccgatgctgcctatatttttgaggatcccttc
accattagagacctgcaggcaaatgttgaacatctggtgcaaaagatgaaaacaactgtg
aagaggggcttggtgttaaggaacgagaagtgcaatgacaactataccactgacttcatc
ttcaacctgtactccgaggaggggaagggcatcttcgacagcaggaagaacgtgcttggc
cacatgcagcagggtgggagcccaactccatttgacaggaattttgccactaagatgggt
gcaaaggctatgaactggatgtctgggaagatcaaagagagttaccgtaatggacggatc
tttgctaatactccagactcaggttgtgttctggggatgcgcaagagagcactgatcttt
caaccagtggctgagctgaaggaacagacagattttgagcatcgcatccccaaggaacaa
tggtggctgaagctgaggcccatcctcaaaatcctagccaagtatgagattgacttggac
acctcagagcacgcccacctggagcacatcagccggaagcggtctggagaagctgccgtc
taa

DBGET integrated database retrieval system