KEGG   Camelus ferus (Wild Bactrian camel): 102516870
Entry
102516870         CDS       T02979                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein isoform X1
  KO
K06618  retinoblastoma-associated protein
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04110  Cell cycle
cfr04218  Cellular senescence
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05212  Pancreatic cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102516870 (RB1)
   04218 Cellular senescence
    102516870 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102516870 (RB1)
   05203 Viral carcinogenesis
    102516870 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102516870 (RB1)
   05225 Hepatocellular carcinoma
    102516870 (RB1)
   05226 Gastric cancer
    102516870 (RB1)
   05214 Glioma
    102516870 (RB1)
   05220 Chronic myeloid leukemia
    102516870 (RB1)
   05218 Melanoma
    102516870 (RB1)
   05219 Bladder cancer
    102516870 (RB1)
   05215 Prostate cancer
    102516870 (RB1)
   05224 Breast cancer
    102516870 (RB1)
   05222 Small cell lung cancer
    102516870 (RB1)
   05223 Non-small cell lung cancer
    102516870 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102516870 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102516870 (RB1)
   05161 Hepatitis B
    102516870 (RB1)
   05160 Hepatitis C
    102516870 (RB1)
   05163 Human cytomegalovirus infection
    102516870 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102516870 (RB1)
   05169 Epstein-Barr virus infection
    102516870 (RB1)
   05165 Human papillomavirus infection
    102516870 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102516870 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cfr01009]
    102516870 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102516870 (RB1)
Protein phosphatases and associated proteins [BR:cfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102516870 (RB1)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    102516870 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 102516870
NCBI-ProteinID: XP_032352039
LinkDB
Position
14
AA seq 934 aa
MPPKTPRRAAAATAAAAAAAEPPPPPPPPPPPPPPEADAEQDSGPEDLPLARLEFEETEE
PDFTALCQKLKVPDHVRERAWLTWEKVSSVDGVLEGYIQKKKELWGICIFIAAVDLDEMP
FTFTELQKSIETSVYKFFDLLKEIDTSTKVDNVMSRLLKKYNVLCALYSKLERTCELIYL
AQPSSSISTEINSMLVLKVSWITFLLAKGEVLQVEDDLVISFQLMLCVLDYFIKLSPPAL
LKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFK
NFIPFMNSLGIVASNGLPEVESLSKQYEEIYLKNKDLDARLFLDHDKTLQADPTDSSEIQ
RTPQKSNPDEEVNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKES
ILKRVKNIGHIFKEKFAKAVGQGCIEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFS
KLLNDDIFHKSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYKVIES
FIKAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPADHLESPCTLNL
PLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANSEAQATSTFQTQKPLRSTSLSLFYKKV
YRLAYLRLNTLCARLLSDHPELEHIIWTLFQYTLQNEYELMRDRHLDQIMMCSMYGICKV
KNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYAST
RPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGLPTPTKMTPRSRILVS
IGESFGTSEKFQKINQMVCNSDRALKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHIPGE
SKFQQKLAEMTSTRTRMQKQKMNDSMDTSHREEK
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagccgctgccaccgccgccgccgccgctgccgcg
gagcccccgccgccgccgccgccgccgccgcccccgccaccgccggaggcggacgccgag
caggacagcggcccggaggacctgcctctcgccagacttgagtttgaagaaactgaagaa
cctgattttactgcattatgtcagaaattaaaggtaccagatcatgtcagagaaagagct
tggttaacttgggagaaagtttcatctgtggatggagtattggaaggttatattcaaaag
aaaaaggaactatggggaatctgtatctttattgcggcagttgacctagatgagatgcca
ttcactttcactgagctgcagaaaagcatagaaaccagtgtctataaattctttgactta
ctaaaagaaattgataccagtaccaaagttgataatgttatgtcaagactattgaagaag
tataatgtactgtgtgcactctacagcaaattagaaaggacatgtgaacttatatacttg
gcacaacccagcagttcgatatctactgaaataaattctatgttggtgctaaaagtctct
tggatcacatttttactagctaaaggggaagtattgcaagtggaagatgatctggtgatc
tcatttcagttaatgctctgtgtccttgactattttatcaaactctcacctcctgcattg
ctcaaagaaccatataaaacagctgtaatacctattaatggttcacctcgaacaccaagg
cgaggtcagaacaggagtgcacggatagcaaaacaactagaaaatgatacaagaattatt
gaagttctctgtaaagaacatgaatgtaatatagatgaggtgaaaaatgtttatttcaaa
aattttatcccttttatgaattctcttggaattgtagcttctaatggacttccagaggtg
gaaagtctctctaaacagtatgaagaaatttaccttaaaaacaaagatctagatgcaaga
ttatttctggatcatgataaaactcttcaggctgatcctacagacagttctgaaatacag
agaactccacaaaaaagtaatcctgacgaagaggtgaatgtgattcttccacagactcca
gttaggactgttatgaataccatccagcaattaatgatgatcttaaattcagcaagtgat
caaccatcagaaaacctgatttcctactttaataattgcacagtgaatccaaaggaaagt
atcctgaaaagagtgaagaatattggacacatctttaaagagaaatttgctaaagctgtg
gggcagggatgtatagaaattggatcacagcgatataaacttggagtccgattgtattac
cgagtaatggaatccatgcttaaatcagaagaagaacgattatccattcagaattttagc
aaactgctgaatgacgacatctttcataagtctttgttggcatgcgctcttgaggttgtt
atggctacatatagcagaagtacgtctcagaatctcgatactggaacagatttgtccttt
ccatggattttgaatgtactcaatttaaaagcttttgatttttacaaagtgattgaaagt
tttatcaaagcagaagccaacttgaccagagaaatgattaaacatttagaacgatgtgaa
catcgaatcatggaatcccttgcatggctctcagattcacctttatttgatcttattaaa
caagcaaaggaccgagagggaccagctgatcaccttgagtctccttgtactctcaacctt
cctctacagaataatcacactgcagcagacatgtatctttctcctgtaagatccccaaag
aaaaaagggtcaactacacgtgtaaattctacggcaaattcagaggctcaagcaacctca
accttccagactcagaagccattgagatctacctccctctcactcttttacaaaaaagtg
taccgactagcgtatcttcgactaaataccctgtgtgcacgccttctgtctgaccatcca
gaactagaacacatcatctggacccttttccagtacacactgcaaaacgagtacgaactc
atgagagacaggcatttggaccagattatgatgtgttccatgtatggcatatgcaaggtg
aagaatatagaccttaagttcaaaatcattgtaacagcatacaaagatcttcctcatgct
gttcaggagacattcaagcgtgttttgatcagagaagaggagtatgattccattatcgtg
ttctataattcagtcttcatgcagagactgaaaacaaacattttgcagtatgcttccacc
aggccacctaccttgtcaccaattcctcacattcctcgaagcccttacaagttttctagt
tcacctttaaggatccctggggggaacatctatatatcacccctaaagaatccatataaa
atttcagaaggtctgccaacgccaacaaaaatgactccaagatcaagaatcttagtatca
attggtgaatcatttgggacttctgagaagttccagaaaataaatcaaatggtgtgtaac
agcgaccgtgcgctcaaaagaagtgctgaaggaagcaaccctcctaaaccgctgaaaaaa
ctgcgctttgacattgaaggatcagatgaagcagatggaagtaaacatatcccaggggag
tccaaatttcaacagaaactggcagaaatgacatctactcgaacacgaatgcaaaagcag
aaaatgaatgatagcatggatacctcacacagggaagaaaagtga

DBGET integrated database retrieval system