KEGG   Camelus ferus (Wild Bactrian camel): 102517716Help
Entry
102517716         CDS       T02979                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfr01002]
    102517716 (TMPRSS9)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102517716 (TMPRSS9)
Peptidases [BR:cfr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102517716 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Ldl_recept_a DUF1986 Trypsin_2 SEA
Motif
Other DBs
NCBI-GeneID: 102517716
NCBI-ProteinID: XP_014416205
LinkDB All DBs
Position
Un
AA seq 940 aa AA seqDB search
MEPATGDLELVPGASKDVLAADTPCCRVVLVSVVATSIVVVTLGVLVGSSPVGAGVRAAL
LVTAERRSRVHRDHFVSSFRKTELQASCVGCTVLSYRDGNSSVLVHFRLHFLQQALRTLS
LGLEEELLQQGLRAGLQGRGIPLAAYGTIVSAQLTGNHKGPPMERDLKSGRCPGNAFSCG
NGQCVTKGNPECDGTADCSDGSDEARCDCGLQPGWRITGRIVGGVGASPGEFPWQVSLRE
NNEHFCGAAVVSARWLVSAAHCFNEFQEPTEWVAYAGTTFLSGSEASTVRARVARIIRHP
SYDPDTADFDLAVLELQGPLPFSRHVQPVCLPAATHVFPPGKKCLISGWGYLKEDFLVKP
ETLQKATVELLDQALCANLYGHSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFL
AGIVSWGIGCAEARRPGVYARVTRLRDWILEAITTASKPLAPTVAPTPAVPSTAWPTSSE
SLVADTPAKPALAPGTPPLHSATASKPQECGARPVLEKPTRIVGGFGAASGEVPWQVSLK
EGSRHFCGATVVGDRWLLSAAHCFNQKGLGTLVLDPSEARELRIPWKPRGAPCRSPEVLG
SLLGPVGAPARSELGLWGPSPARSTKPDILQWASVGIIDQKACSALYNFSLTDRMICAGF
LEGRVDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQARKPGVYTRITRLKGWILDTM
AFQPLPTPPPAGLTVPGVVASTPTPRATSQPANRTATGLTTATRGQTPLPHALEVTAGPQ
LPDCGLAPVATLTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVADKWLLSAAHCFDV
FGGPQAVGGLAALGLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPS
GRWVLTGVTSWGYGCGRPQFPGVYTRVAAVRGWIGQNIQE
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgccaccggggacttagaactggtgcccggggcctccaaggatgtcctggct
gcggacaccccatgctgccgggtggtcctcgtgtctgtggtggccaccagcatcgtcgtc
gtcaccctgggagtccttgtggggtccagccccgtgggagcgggtgtcagggctgctctc
ctggtcacggccgagcgccgctcccgtgtgcacagggaccactttgtaagcagctttcgg
aagacagagctgcaggccagctgcgtgggctgcacggtgctgagttacagggacgggaac
tccagcgtcctcgtgcacttccggctgcactttctgcagcaagccctccggacgctgagc
ctggggctggaggaggagctgttacagcaggggctccgggccgggctgcagggacgcggc
atccccctggccgcctacggcaccatcgtgtccgcccagctcacaggcaaccacaagggg
ccaccgatggaaagagacttaaaatcaggtcgctgtcccgggaacgccttttcctgcggg
aacggccagtgtgtgaccaagggcaacccggagtgtgacggcacagcagactgctccgac
ggctccgacgaggcccgctgtgactgtggtttgcagcctggctggaggatcaccggcagg
attgtgggtggtgtgggagcatccccaggggagttcccttggcaagtcagcctccgagaa
aacaacgaacacttctgtggagccgctgtcgtcagtgccaggtggttggtgtctgctgcc
cactgcttcaacgagttccaggagcccacggagtgggtggcctacgcgggcaccaccttc
ctcagcggctcggaggccagcacggtgcgggcccgcgtggcccggatcatcaggcacccc
tcctacgacccggacacggccgacttcgacctggcggtgctcgagctgcaaggccccctg
cccttcagcagacacgtgcagccggtgtgcctcccggccgccacccacgtcttcccgcct
gggaagaagtgtctgatctcgggctggggctacctcaaggaggacttcctggtcaagccg
gagacgctgcagaaggccaccgtggagctgctggaccaggccctgtgcgccaacctgtac
gggcactcgctcaccgacaggatgctctgcgccggctatctggatgggaaggtggattcc
tgccagggcgactcgggaggacccctggtctgcgaggagccctctggcaggtttttcctg
gctggcattgtgagctggggaattggttgtgcggaagcccggcgtccaggggtctacgct
cgagtgaccaggctgcgtgactggatcctggaggccatcaccacagcaagcaagcctctg
gcccccacggtggctcccacccccgctgtccccagcactgcctggcccaccagctccgag
agcctggtggccgacacccctgccaaacccgcgctggcccccggcaccccacctctccac
tcagccaccgcttctaagccgcaagagtgcggggccaggccggtgctggagaagcccacc
cggatcgtgggcgggtttggagccgcctccggagaggtgccctggcaggtcagcctgaag
gaggggtcccggcacttctgcggagccaccgtggtgggggatcgctggctgctgtcagct
gcccactgcttcaatcagaaaggcttggggacccttgtgttagacccttcagaggcccga
gagctaaggattccttggaagccccggggcgccccctgcaggtcacccgaggtgctgggg
agtctgctggggccagtgggggcgcccgcgcgctccgagctgggcctctggggcccatct
cctgcacgctccaccaagccggacatcctccagtgggcgtccgtgggcatcatagaccag
aaggcgtgcagcgccctctacaacttctcgctcacggacaggatgatctgtgccggcttc
ctggagggcagggtcgactcctgccagggtgactctgggggacccctggcctgtgaggag
acccctggcgtgttttacttggcgggcatcgtgagctggggcatcggctgtgcccaggcc
aggaaaccaggcgtgtacacgcgaatcaccaggctgaagggctggatcctggacaccatg
gccttccagcccctccccacacccccgccggctggcctcacagtcccaggggttgtggcc
agcacacccactccccgggccaccagccaacctgccaacaggactgccaccggcctgacc
acagctaccaggggacagacaccacttccacatgccctagaggtcaccgcgggcccccag
ctcccagactgcggcctggcgccggtggccacactgaccaggatcgtgggtggcagtgct
gcaggccgtggggagtggccgtggcaggtgagcctgtggctgcggcggcgggagcaccgc
tgtggggccgtgctggtggctgacaagtggctgctgtcggcagcgcactgcttcgatgtc
ttcgggggaccccaggcagtgggcggccttgcggccctgggcctcctcagtgagcagacc
tgccgccgcttctacccggtgcagatcagcagtcgcatgctgtgcgctggcttcccacag
ggcggcgtggacagctgctcgggtgatgctgggggacccctggcctgcagggagccctcc
ggccggtgggtgctaactggggtcaccagctggggttacggctgtgggcggccccagttc
ccaggcgtctacacccgggtggctgcagtgagaggctggatcgggcagaatatccaagag
tga

DBGET integrated database retrieval system