KEGG   Camelus ferus (Wild Bactrian camel): 102518006Help
Entry
102518006         CDS       T02979                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00052  Galactose metabolism
cfr00500  Starch and sucrose metabolism
cfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102518006 (GANC)
   00500 Starch and sucrose metabolism
    102518006 (GANC)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102518006 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102518006
NCBI-ProteinID: XP_006178920
LinkDB All DBs
Position
Un
AA seq 913 aa AA seqDB search
MEAAGKEEISVEDEAVDKTIFKDCSKIAFYRRQKQRLTEKAAYQALLDSVTTGKDSTRFQ
IINEVAKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPSTVRLTSCSGDTGS
LVLADGKGDLKCHITANPFKVDLVSEEEVVMSINSLGQLYFEHLQNPLMQRATKENEDTS
VDTTQENQDELCLWEEKFENFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNTG
DGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEISTEPAVK
YTLTQMGPVAAKQKVESRTDVRWMSESGIIDVFLLTGPTPSDVFRQYSYLTGTQAMPPLF
SLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKRM
QELLRSKKRKLVVISDPHIKVDPNYSVYAKAKEQGFFVRNHDGGDFEGVCWPGLSSYLDF
TNPKVREWYSSLFAFSVYQGSTDILHVWNDMNEPSVFRGPELTMQKNAIHHGNWEHRELH
NIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISVPM
LLTLSITGISFCGADIGGFIGNPEAELLVRWYQAGAYQPFFRSHATKNTRRREPWLFGEK
HTQLIREAIRERYALLPYWYSLFYFAHVASQPVMRPLWIEFPGELETFGVEDEYMLGSAL
LVHPVTEPKATVVDVFLPGSNEVWFDSKTFSHWKGACTVKIPVSLDTIPVFQRGGSVVPI
KTTIGKSTGCMTDSPYGLRVALSTKGSAVGEVYLDDGHSFQYLHQKQFLHRKFSFSSGVL
INSCADERGRYPSKCVVEQIFVLGLKKQPSSVTAHSSDGKAQPVAFTYCAKTSTLSLEKL
SLNIGADWKVHIQ
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgggaaagaggaaatcagtgttgaagatgaagctgtggataaaaccatt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagcggctcaccgagaag
gctgcctatcaggcattactagattcagtcacaacaggcaaagacagcaccaggtttcaa
attatcaacgaagtagctaaggttcctctcctagctgaagtttatggtatagagggaaat
attttcaggcttaaaatcaatgaagaaacacccctgaagcccaggtatgaagttcccgat
gtcctcacaagcaagccaagcactgtaaggctgacttcatgctcaggggatacaggcagt
ctggtattggcagatggaaaaggagatctgaagtgtcatataacagcaaacccattcaag
gtagacttggtgtctgaagaagaggtggtgatgagcataaactccctgggccagttgtac
tttgagcacctgcagaatcctctcatgcaaagagctaccaaggaaaatgaggatacatca
gttgacaccactcaggaaaatcaggatgaactgtgcctgtgggaggagaaatttgaaaat
tttgtggatgtcaaagttaatggtcctgcctccattggtttggatttctccttgcatgga
tttgaacatctctatgggatcccacaacatgcagaatcacaccaacttaaaaatactggt
gatggggatgcttaccgactttataacctagatgtctacggatataaaatacatgacaaa
atgggcatttatggttcagtgccttatctcctggcccacaaactgggcaggactctaggc
attttttggctgaatgcctcagaaacactagtggagatcagtacagaacctgcagtaaag
tacacactgacccaaatgggcccagttgccgctaaacagaaggtcgaatctcgaactgat
gtgcgctggatgtcagagagtggaatcattgatgtttttctgctgacaggacctacacct
tctgacgtcttcaggcagtactcataccttacaggcacacaggccatgcccccgctcttc
tccttggggtaccatcagtgccgctggaactatgaagatgagcaggatgtaaaagcagtg
gatgcaggatttgatgaacatgacattccttacgacgtcatgtggctggacatagagcac
accgagggcaaaaggtacttcacctgggacaagaaaagattcccaaatcccaaaaggatg
caagagctgctcaggagcaaaaaacgtaagcttgtggtcatcagtgacccccacatcaag
gttgatcccaactactcagtgtatgctaaggccaaagaacagggcttcttcgtgaggaat
catgatgggggtgactttgaaggtgtatgctggcctggtctctcctcctacctggatttc
accaatcccaaggtcagagagtggtattcaagcctttttgccttctctgtttatcagggg
tctactgacatcctgcacgtgtggaatgacatgaatgagccctctgtctttagagggcca
gagctaaccatgcagaagaatgccattcatcatggcaactgggagcaccgagaacttcac
aatatctatggcttttatcagcaaatggccactgcagaaggactgatccagcgatctaaa
gggaaggagagacccttcgttcttacacgttctttctttgctggatcacaaaagtatggt
gctgtgtggacaggtgacaacacagcagaatggagttacctgaaaatttctgtccctatg
ttactgacccttagcattactgggatctctttttgtggagctgacatcggtggcttcatc
gggaacccagaggcagagctgctagtgcgatggtaccaggccggagcctaccagcccttc
ttccgcagccatgctaccaagaacaccaggcgacgggaaccctggctctttggagagaag
cacacccagctcatccgcgaagccatcagagagcgctatgccctcctgccctattggtat
tctctgttctactttgcacacgtggcttcccaacccgtcatgagacctctatggatagag
tttcctggtgaattagagacttttggtgtggaagatgaatacatgttgggaagtgcttta
ttggttcatccagtcacagaaccaaaagccactgtggttgatgtgtttctgccaggatca
aatgaggtctggtttgactctaagacgttttctcattggaaaggagcatgtactgtaaag
atcccagtatccctggacactataccagtgtttcagcgaggtggaagtgtggtaccaata
aagacaactataggaaaatctacaggctgcatgactgattccccatatggcctccgggtg
gccctaagcactaagggttctgccgtgggtgaagtctatctcgatgatggccattcattc
cagtacctccaccagaagcaattcttgcacagaaagttttcgttctcctcaggtgttttg
atcaacagttgtgccgacgagaggggtcgttatcccagcaagtgtgtagtggagcagatc
tttgtcctaggcctcaagaagcagccgtcttctgtgaccgcccactcatctgatggtaaa
gctcagcccgtggcttttacatattgtgccaaaacgtccaccctgagcctggagaagctc
tcgctgaacattggcgctgactggaaggtccacatccagtga

DBGET integrated database retrieval system