KEGG   Camelus ferus (Wild Bactrian camel): 102518228
Entry
102518228         CDS       T02979                                 

Gene name
GAB2
Definition
(RefSeq) GRB2-associated-binding protein 2 isoform X1
  KO
K08091  GRB2-associated-binding protein 2
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04014  Ras signaling pathway
cfr04071  Sphingolipid signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04380  Osteoclast differentiation
cfr04664  Fc epsilon RI signaling pathway
cfr04666  Fc gamma R-mediated phagocytosis
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102518228 (GAB2)
   04072 Phospholipase D signaling pathway
    102518228 (GAB2)
   04071 Sphingolipid signaling pathway
    102518228 (GAB2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    102518228 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    102518228 (GAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102518228 (GAB2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102518228 (GAB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cfr04990]
    102518228 (GAB2)
Domain-containing proteins not elsewhere classified [BR:cfr04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   102518228 (GAB2)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_3 PH_2 PH_8
Other DBs
NCBI-GeneID: 102518228
NCBI-ProteinID: XP_032344634
LinkDB
Position
10
AA seq 685 aa
MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQ
AEESTGLFLLSTDSLRNISSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFE
PPASNHVQPALSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQG
NGHCVNGVSGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVY
TFKMPSNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMAVATPGDSAIAPPP
RPPKPSQAETPRWGSPQQRPPAGESSRSVSAAATIPRRNTLPAMDNSRLHRASSCESYDY
PQRGGDSAGRSAESTSEAVSAFLPGKTVVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDN
SQSAYIPMSPGPHHFDPLGYPSTALSMHRGSSRGSEIQPPPVNRNLKPDRKAKPTPLDLR
NNTVIDELPFKSPVTKSWSRAIHSFNPGSSQYCRPISTQSITSTDSGDSEENYVPMQNPV
SASPIPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKT
QALQNTMQEWTDVRQSSEPSKGAKL
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgagcggcggcggcgacgtggtgtgcaccggctggctcaggaaatcgcccccggagaag
aagttgaggcgctatgcctggaagaaacgctggtttatcctgcggagtggccggatgagt
ggtgacccggatgtgctggagtactacaagaatgatcactccaagaagcccctgcggatc
atcaacctgaacttctgcgagcaggtggatgcaggcctgaccttcaacaagaaggagctg
caggatagttttgtgtttgacatcaagaccagcgagcgcaccttttacctggtggccgag
acggaggaggacatgaataagtgggtccagagcatctgccagatctgcggcttcaatcag
gccgaggagagcacagggctctttctcctttccacagactccctgagaaacatttcctct
gccggtcacggcccccgctcttctccagctgagctcagcagctccagtcagcaccttctc
cgagaacggaagtcctcagccccatcgcactccagccagccaaccttgttcaccttcgaa
cccccggcgtcaaaccacgtgcagcccgccttgtccaccagtgcacctcaggagtacctc
tacttgcaccagtgcataagccggagagcagaaaatgcaaggagtgccagcttctctcag
ggcaccagggcctcgtttctcatgaggagtgacacagccgtgcagaaacttgcccagggc
aatggacactgtgtcaatggggtcagcggtcaagtccatggcttctacagccttcccaag
ccgagccggcacaatacggaattcagagacagcacctacgacctcccccggagcctggcc
tcccatggccacaccaagggcagcctcacgggctctgagacagataacgaggatgtgtat
accttcaagatgcccagcaacaccctgtgccgtgagtttggggacctcctggtggacaat
atggacgttccggccaccccactctcagcctaccagatccctagaacgttcacgctggac
aagaaccacaatgccatggcagtggccactcctggggactcagccatagctcccccgccc
cggccccccaagccaagccaagctgagacacctcgatggggcagccctcagcagagacct
ccagccggggaaagcagcagatcagtctctgccgctgcaaccatccccagacgcaacacc
cttccagccatggacaacagccgacttcaccgagcttcttcctgcgaatcctacgactac
ccccagcgtggtggagacagtgcaggccgctctgccgagtccacgagtgaggcagtcagc
gccttcctgccagggaaaacagtcgtgggccgatcagatagcaccaattctgaggacaac
tacgtgcccatgaatccaggctcctccaccctgctggccatggagcgagcaggtgataat
tcccagagtgcctacatccccatgagcccagggccccatcactttgacccgctcggctac
ccatctacagccctgtctatgcaccgcggctccagccgagggagtgagatccagccacct
cctgtcaaccgcaacctcaaacctgaccggaaagcaaagccaacaccacttgacctgaga
aataacaccgtcattgatgagctccccttcaagtcacccgtcaccaagtcttggtctcgg
gccatccactccttcaaccccggctcctcccaatactgccgccccatctccacccagagc
atcaccagcacggactcgggagacagcgaggagaactatgtccctatgcaaaatccagtg
tctgcatctcccattcccagtggcaccaacagtccagcccctaagaagagcacgggcagc
gtggattatctggccctggacttccagccgagctccccaagcccccaccgcaagccatcc
acgtcatccgtcacttctgacgagaaggtagactacgttcaagtggacaaggagaagacc
caggccctgcagaacaccatgcaggagtggacggacgtgcggcagtcctcggagccttcc
aagggtgccaagctgtga

DBGET integrated database retrieval system