KEGG   Camelus ferus (Wild Bactrian camel): 102518309
Entry
102518309         CDS       T02979                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04152  AMPK signaling pathway
cfr04218  Cellular senescence
cfr04310  Wnt signaling pathway
cfr04340  Hedgehog signaling pathway
cfr04371  Apelin signaling pathway
cfr04390  Hippo signaling pathway
cfr04510  Focal adhesion
cfr04530  Tight junction
cfr04630  JAK-STAT signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05216  Thyroid cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
cfr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102518309 (CCND1)
   04340 Hedgehog signaling pathway
    102518309 (CCND1)
   04390 Hippo signaling pathway
    102518309 (CCND1)
   04371 Apelin signaling pathway
    102518309 (CCND1)
   04630 JAK-STAT signaling pathway
    102518309 (CCND1)
   04068 FoxO signaling pathway
    102518309 (CCND1)
   04151 PI3K-Akt signaling pathway
    102518309 (CCND1)
   04152 AMPK signaling pathway
    102518309 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102518309 (CCND1)
   04115 p53 signaling pathway
    102518309 (CCND1)
   04218 Cellular senescence
    102518309 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102518309 (CCND1)
   04530 Tight junction
    102518309 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102518309 (CCND1)
   04921 Oxytocin signaling pathway
    102518309 (CCND1)
   04919 Thyroid hormone signaling pathway
    102518309 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102518309 (CCND1)
   05206 MicroRNAs in cancer
    102518309 (CCND1)
   05205 Proteoglycans in cancer
    102518309 (CCND1)
   05203 Viral carcinogenesis
    102518309 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102518309 (CCND1)
   05212 Pancreatic cancer
    102518309 (CCND1)
   05225 Hepatocellular carcinoma
    102518309 (CCND1)
   05226 Gastric cancer
    102518309 (CCND1)
   05214 Glioma
    102518309 (CCND1)
   05216 Thyroid cancer
    102518309 (CCND1)
   05221 Acute myeloid leukemia
    102518309 (CCND1)
   05220 Chronic myeloid leukemia
    102518309 (CCND1)
   05218 Melanoma
    102518309 (CCND1)
   05219 Bladder cancer
    102518309 (CCND1)
   05215 Prostate cancer
    102518309 (CCND1)
   05213 Endometrial cancer
    102518309 (CCND1)
   05224 Breast cancer
    102518309 (CCND1)
   05222 Small cell lung cancer
    102518309 (CCND1)
   05223 Non-small cell lung cancer
    102518309 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102518309 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102518309 (CCND1)
   04934 Cushing syndrome
    102518309 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102518309 (CCND1)
   05162 Measles
    102518309 (CCND1)
   05160 Hepatitis C
    102518309 (CCND1)
   05163 Human cytomegalovirus infection
    102518309 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102518309 (CCND1)
   05169 Epstein-Barr virus infection
    102518309 (CCND1)
   05165 Human papillomavirus infection
    102518309 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102518309 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102518309
NCBI-ProteinID: XP_032345965
LinkDB
Position
10
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGGSSSFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgaagtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgtgcgccc
tccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagttgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagttgctcctggtgaacaaactcaagtggaacctggcggccatgaccccgcacgacttc
atcgagcacttcctctccaaaatgccggtggctgaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgtcgccctttgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggctgctgggagtgtggtggccgcggtgcaaggcctgcacctgggaggctcc
agcagcttcctgtcttaccaccgcctcacgcggttcctttccaaagtgatcaggtgtgac
ccggactgcctccgtgcgtgccaggagcagatcgaagccctcctggagtccagcctgcgc
caggcccagcagcagaacctggaccccaaggccgcagaggaggaggaggaagaggaggag
gtcgacctggcctgcacgcccaccgacgtgcgggacgtgaacatttga

DBGET integrated database retrieval system