KEGG   Camelus ferus (Wild Bactrian camel): 102518523
Entry
102518523         CDS       T02979                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00220  Arginine biosynthesis
cfr00330  Arginine and proline metabolism
cfr01100  Metabolic pathways
cfr04020  Calcium signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04146  Peroxisome
cfr04371  Apelin signaling pathway
cfr04926  Relaxin signaling pathway
cfr05010  Alzheimer disease
cfr05014  Amyotrophic lateral sclerosis
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05133  Pertussis
cfr05140  Leishmaniasis
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05146  Amoebiasis
cfr05152  Tuberculosis
cfr05200  Pathways in cancer
cfr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102518523 (NOS2)
   00330 Arginine and proline metabolism
    102518523 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102518523 (NOS2)
   04066 HIF-1 signaling pathway
    102518523 (NOS2)
   04020 Calcium signaling pathway
    102518523 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102518523 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102518523 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102518523 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102518523 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102518523 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102518523 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    102518523 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102518523 (NOS2)
   05152 Tuberculosis
    102518523 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102518523 (NOS2)
   05145 Toxoplasmosis
    102518523 (NOS2)
   05140 Leishmaniasis
    102518523 (NOS2)
   05142 Chagas disease
    102518523 (NOS2)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102518523 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102518523
NCBI-ProteinID: XP_006184975
LinkDB
Position
16
AA seq 1157 aa
MACPWKFLFRTKSNQFDLTEELDINNNVQKACQVPSSPVTQDDPKSHSLSKHRDESPWPL
TGAVKKSPESLVKLDASLWASPQHVRIKNWGSGMTFHDTLHQKAKRDLACKSKSCLGAVM
NPKSLTIGPRDKPTSPDELLPQAIEFVNQYYSSFKEAKIDEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTIRGDPASVEFTQLCINLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKVASLWKDRAVVEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWVWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDERRRPRRREIRFKVLVKAVLFTSVLMCKTMASRVRAT
ILFATETGRSETLAGDLGALFSCAFNPKVLCMDEYSLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPIGEGD
ELSGQEEAFRSWAMQTFKAACETFDVRGKHHIQIPKLYTSSVTWDPHHYRLVQDSQPLDL
SKALSSMHAKHVFTMRLKSRQNLQSPKSSRTTLLVELSCEGSQGLSYLPGEHLGVFPGNQ
PALVQGILERVVDGPAPHQPMRLETLSENGSYWVQDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLALLATEEAERQKLEALCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRDCTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDLVPCF
VRSASGFQLPEDPSRPCILIGPGTGIAPFRSFWQQRLHDAEHKGLQGGHMTLVFGCRRPD
EDHLYREEMLELARKGVLHEVHTAYSRLPGQPKVYVQDILRQQLAGEVLRVLHEEQGHLY
VCGDVRMARDVACTLKQLVAAALTLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYELKKDG
SAGPPSDPQAPVAWRRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggaagtttctgttcaggaccaaatccaaccaatttgatttgactgag
gaattggacattaacaacaacgtgcagaaagcctgccaggttccctccagtccagtgaca
caggatgaccccaaaagtcacagcctcagcaagcaccgggatgagtccccctggcccctc
acgggggcggtaaagaaatctccagaatccctggtcaagctggatgcatccctatgggcc
agcccacagcatgtgaggatcaaaaactggggcagcgggatgactttccacgacacactt
caccaaaaagccaaacgggatctcgcttgcaagtccaagtcttgcctgggagccgtcatg
aaccccaaaagtttgaccataggacccagggacaagcctacctccccagatgaacttcta
cctcaagctatcgaatttgtcaaccagtattacagctccttcaaagaggcaaaaatagat
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacaggagatgagctcatctttgccaccaagcaggcctggcgcaacgccccccgctgc
atcggcaggatccagtggtccaacctgcaggtcttcgacgcccggagctgttccactgcc
caggaaatgttcgagcacatctgcagacacctgcgttactccaccaacaacggcaacatc
aggtcggccatcaccgtgtttccccagcggagcgatgggaagcacgacttccgagtctgg
aatgctcagctcatccggtatgccggctaccagatgcctgatggcaccatcaggggggac
cctgcctccgtggagttcacccagctgtgcatcaacctaggctggaagcctaagtacggc
cgcttcgatgtggtgcctctggtcctgcaggctaatggccgcgaccctgagctcttcgaa
atcccacctgaccttgtgctcgaggtgcccatggaacatcccaagtacgagtggttccgg
gagctggagctaaagtggtatgccctgccggccgtggccaacatgctgctggaggtgggt
ggccttgagttcccaggatgccccttcaacggctggtacatgggcacggagatcggggtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacacacaaggtagcctcactctggaaggaccgggctgtcgttgagatcaacgtt
gctgtgctccacagtttccagaagcagaatgtgaccatcatggaccaccactcagctgca
gaatccttcatgaagtacatgcagaatgagtaccggtcccgagggggctgcccggcggac
tgggtttggctggtccccccgatttctggaagcatcacccccgtattccaccaggagatg
ttaaattatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaagatgagaggaggagaccccggagaagagagattcgattcaaagtcttggttaaa
gccgtgctcttcacctcagtgctgatgtgtaagaccatggcgtcccgggtcagagccaca
atcctctttgcaacggagacgggaagatcggaaacgctggccggggacctgggggccttg
ttcagctgtgccttcaaccccaaggttctctgcatggacgagtacagcctgagccacctg
gaggaggagcagctgctgctggtggtgaccagcacgtttgggaatggagactcccctggc
aacggagagaaactgaagaagtccctcttcatgctgaaagaactcaccaacaagttcagg
tatgctgtgtttggccttggctccagcatgtaccctcagttctgtgcctttgctcatgac
atcgaccagaagttgtcccacctgggggcttctcagctagccccaataggagaaggggac
gagctcagcgggcaggaggaggccttccgcagctgggccatgcaaaccttcaaggcggcc
tgtgagacgttcgatgtccgaggcaaacaccacattcagatccccaagctctacacgtcc
agtgtgacctgggacccacaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagcatgtgttcaccatgaggctcaaatcacgg
cagaatctacagagtccgaaatccagccgcaccaccctcctggtggaactctcttgtgag
ggcagccaaggtctgagctacctgccaggagagcacctcggagttttcccgggcaaccag
ccggcccttgtccaaggcatcttggagcgagtggtggacggccctgcaccccaccaaccc
atgcgcctggagaccctcagcgagaacggcagctactgggtccaggacaagcggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccag
ctgctgctccgaaagttggccctgctggctacagaagaggcagagaggcagaaactggag
gccctgtgccagccctcagagtacaacaagtggaagttcaccaatagccccacattcctg
gaggtgctggaggagttcccgtctctgcgggtgtctgctggcttcctgctctcccagctc
cctattctgaagccccggtactactccatcagctcctccagggactgcacacccacggag
atccacctcaccgtggctgtgctcacataccgcacccgagatggccagggtcccctgcac
catggtgtctgcagcacatggcttagcagcctgaagccccaagacctggtgccctgcttt
gtgcgaagtgccagtggcttccagctgcctgaggacccctcccgtccttgcatcctcatc
gggcctggcacgggcatcgcccccttccgcagtttctggcagcagcggctccatgatgct
gagcacaaagggctccagggtggccacatgaccctggtgttcgggtgccgccgcccggat
gaggaccatctctacagggaggagatgttggagttggcccggaagggggtgctgcatgag
gtgcacacggcctattctcgcctgcctggccagcccaaggtttacgttcaagacatcttg
cggcagcagctggccggtgaggtgctccgtgtgctccatgaggagcaaggccacctctat
gtctgtggggatgtgcgcatggcccgtgatgtggcctgcaccctgaagcagctggtggct
gccgcgctgaccctgaatgaggagcaagtggaggactatttctttcagcttaagagccag
aagcgctaccatgaagatatctttggtgctgtatttccctacgagctaaaaaaggatggg
tcagcagggccgcccagtgatccccaagctcccgtagcctggaggagaagttaa

DBGET integrated database retrieval system