KEGG   Camelus ferus (Wild Bactrian camel): 102518832
Entry
102518832         CDS       T02979                                 

Definition
(RefSeq) cadherin-1 isoform X2
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04015  Rap1 signaling pathway
cfr04371  Apelin signaling pathway
cfr04390  Hippo signaling pathway
cfr04514  Cell adhesion molecules
cfr04520  Adherens junction
cfr05100  Bacterial invasion of epithelial cells
cfr05200  Pathways in cancer
cfr05213  Endometrial cancer
cfr05216  Thyroid cancer
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102518832
   04390 Hippo signaling pathway
    102518832
   04371 Apelin signaling pathway
    102518832
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102518832
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102518832
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102518832
  09162 Cancer: specific types
   05226 Gastric cancer
    102518832
   05216 Thyroid cancer
    102518832
   05218 Melanoma
    102518832
   05219 Bladder cancer
    102518832
   05213 Endometrial cancer
    102518832
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102518832
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfr03036]
    102518832
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cfr04515]
    102518832
   04090 CD molecules [BR:cfr04090]
    102518832
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102518832
Cell adhesion molecules [BR:cfr04515]
 Cadherins
  Major cadherins
   102518832
CD molecules [BR:cfr04090]
 Proteins
  102518832
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 RET_CLD1 Cadherin_3 RibLong
Other DBs
NCBI-GeneID: 102518832
NCBI-ProteinID: XP_006180651
LinkDB
Position
9
AA seq 885 aa
MGPPCHNLSPLLLLLLLQVSPWLCQEPEPCNPGFGAESYTFTVPRRHLERGRVLGKVSFE
GCTGQPRTVYVSDDTRFKVGTDGVVAVKRPLQLHNPEMSFHVHAWDSTRRKLSTKVTLKA
PGHHHHHHHHHDSLSGTQTEVLTFPGSHHGLRRQKRDWVIPPISCPENEKGPFPKDLVQI
KSNREKETKVFYSITGQGADKPPVGVFIIERETGWLKVTEPLDREAIAKYILYSHAVSSN
GEAVEDPMEIVITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMQVTATDADDDVNTYNA
AIGYSIIDQEPMLPHNKMFTINKDTGVISVLTTGLDRESFPTYTLVVQAADLQGEGLSTT
ATAVITVTDINDNPPVFSPTMYQGSVYENEANAVITTLKVTDADVPNTPAWEAVYTVLND
KEKQFVVITDPVTNDGILKTAKGLDFEAKQQYILYVAVNNVAAFEVTLSTSTATITVDVM
DVNEAPIFVPPQKRVEVPEDFSVGLEITSYTAQEPDTFMEQKITYRIWRDAANWLEINPD
TGAITTRAELDRENLEHVKNSTYTALIIATDNGSPPATGTGTLLLFLSDVNDNGPIPEPR
IMDFCQRNPQPHIISIIDPDLPPNTSPFAAELTHGASVNWTIEYNDPEHESLILKPKKTL
ELGDYKINLKLIDNQNKDQVTTLEVHVCDCEGVVSNCRKTGTFNQAGLQVPAILGILGGI
LAFLILILLLLLLVRRRRVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLD
ARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEG
SGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgggccccccgtgtcacaacctctccccgcttctgctgctgctgctgctgcaggtctca
ccgtggctctgccaggagccggagccctgcaatcctggctttggcgccgagagctatacg
ttcaccgtgccccggcggcacttggagagaggtcgagtcctgggcaaagtgagttttgaa
ggatgcactggtcaaccaaggacagtctacgtttctgatgacacccggttcaaagtgggc
acagatggcgtggttgcagtcaaacggcctttacaacttcataatccagagatgagtttt
catgtccatgcctgggattccacccgcagaaagctctccaccaaagtgacgctgaaggca
ccagggcaccaccatcaccaccaccatcatcatgactctctctctggaacccagacagaa
gtgctcacatttcctggctcccaccatggtctcagaagacagaagagagactgggttatc
cctcctatcagctgcccggaaaatgagaaaggcccctttcctaaggatctggtccagatc
aaatctaatagggaaaaagaaaccaaggttttctacagcatcactggccaaggagctgac
aaacccccggttggtgtgtttattattgaaagagaaacaggatggctaaaggtgacggag
cctctggatagagaagccattgccaagtacattctctactctcatgctgtgtcttcgaac
ggggaagcagttgaggacccgatggagattgtgatcactgtgaccgatcagaatgacaac
aagccagagttcacccaggaggtctttaaggggtccgtcatggagggagctctcccaggg
acctctgtgatgcaggtcacggccacagacgcagacgacgatgtgaatacctacaacgct
gccattggttacagcatcatcgaccaagaacctatgctgcctcacaacaaaatgttcacc
atcaacaaggacacgggagtcatcagcgtgcttaccaccgggctggaccgggagagtttt
cccacgtacaccctggtggttcaagctgcagaccttcaaggtgaaggcttaagcacaacc
gcaacagccgtgatcacagtcactgacatcaacgataaccctcccgtcttcagcccgacc
atgtaccaggggtcagtgtatgagaatgaggcgaatgcggtgatcactacgctcaaagtg
accgatgccgatgtccccaacacccctgcgtgggaggctgtttacacagtattaaatgat
aaggagaagcagtttgttgtcatcacagacccagtgaccaatgatggcattttgaaaacg
gctaagggcttggattttgaggccaagcagcagtacattctgtacgtggcagtgaataac
gtggccgcctttgaggtcactctctccacttccacagccaccatcaccgtggatgtgatg
gatgtgaacgaagcccccatctttgtgcctcctcaaaagagagtggaagtgccagaagac
ttcagcgtgggcctggagatcacgtcctacaccgcccaggagcctgacacatttatggag
cagaagatcacgtatcggatttggagggacgctgccaactggctggagattaatccggac
acgggtgccattaccactcgggctgagctggacagagagaacttggagcacgtgaagaac
agcacgtacacggccctcatcatagccactgacaacggttctccacctgctactggaacg
ggaacccttctcctgttcctctccgatgtgaatgacaacggccccataccagaacctcgg
attatggacttctgccagaggaatccacagcctcatatcatcagcatcatcgatccagat
cttccccctaacacgtctccctttgcagcagaactaacacacggggcaagtgtcaactgg
accattgagtacaatgacccagaacacgaatctctcattttgaagccaaagaagacttta
gagttgggagactacaaaataaatctcaagctcatagacaaccagaacaaagaccaggtg
accaccttagaggtgcacgtgtgcgactgtgaaggggtcgtcagcaactgtaggaagact
gggactttcaaccaggcaggactgcaagttcccgccatcctggggattcttggaggcatc
cttgcttttctgatcctgattctgttgcttctgctacttgttcggaggagaagggtggtc
aaagagcccttactgcccccagaagacgacactcgggacaatgtttattactatgatgaa
gaaggaggtggagaagaggaccaggactttgacttgagccagttacacaggggcctggac
gctcggcccgaagtgactcgcaatgatgtggcgccaaccctcatgagtgtgccccagtat
cggccccgccccgccaaccctgatgaaattggaaactttattgacgaaaacctgaaggca
gctgatagtgaccccactgccccgccctatgactctctgctcgtctttgattacgaagga
agtggttctgaagctgctagtctgagctccctgaactcctcggagtcagaccaagaccag
gactacgactacctgaatgaatggggcaatcgcttcaagaagctggcggacatgtatgga
ggcggcgaagatgactag

DBGET integrated database retrieval system