KEGG   Camelus ferus (Wild Bactrian camel): 102518884
Entry
102518884         CDS       T02979                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr04012  ErbB signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04151  PI3K-Akt signaling pathway
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr04934  Cushing syndrome
cfr05162  Measles
cfr05165  Human papillomavirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05206  MicroRNAs in cancer
cfr05215  Prostate cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102518884 (CDKN1B)
   04066 HIF-1 signaling pathway
    102518884 (CDKN1B)
   04068 FoxO signaling pathway
    102518884 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102518884 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102518884 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102518884 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102518884 (CDKN1B)
   05206 MicroRNAs in cancer
    102518884 (CDKN1B)
   05203 Viral carcinogenesis
    102518884 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102518884 (CDKN1B)
   05220 Chronic myeloid leukemia
    102518884 (CDKN1B)
   05215 Prostate cancer
    102518884 (CDKN1B)
   05222 Small cell lung cancer
    102518884 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102518884 (CDKN1B)
   04934 Cushing syndrome
    102518884 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102518884 (CDKN1B)
   05169 Epstein-Barr virus infection
    102518884 (CDKN1B)
   05165 Human papillomavirus infection
    102518884 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102518884 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102518884
NCBI-ProteinID: XP_032328867
LinkDB
Position
34
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEANQLKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQEGQDVSGTRQAVPLIG
SQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSPQNKRANRSEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctcggcctgcagaaacctcttcggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgccgagacatggaagaagccaaccagctcaagtgg
aattttgattttcagaatcacaagcccctggagggcaaatacgagtggcaagaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagggccaggatgtcagcgggacccgccaggcggtgcctttaattggg
tcccaggccaactcagaggacacgcatttggtagaccaaaagactgatgcaccggacagc
cagacgggcttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tctcctcaaaacaaaagagccaacagatcagaagaaaacgtttcagacggttcccccaac
gcgggttcagtggagcagacgcccaagaagcccggcctcagaaggcgtcaaacgtaa

DBGET integrated database retrieval system