KEGG   Camelus ferus (Wild Bactrian camel): 102519252
Entry
102519252         CDS       T02979                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X2
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00310  Lysine degradation
cfr01100  Metabolic pathways
cfr04010  MAPK signaling pathway
cfr05200  Pathways in cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102519252 (MECOM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102519252 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102519252 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102519252 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102519252 (MECOM)
   03036 Chromosome and associated proteins [BR:cfr03036]
    102519252 (MECOM)
Enzymes [BR:cfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     102519252 (MECOM)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    102519252 (MECOM)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102519252 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 Zn-ribbon_8 zf-met zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 102519252
NCBI-ProteinID: XP_014417569
LinkDB
Position
1
AA seq 1239 aa
MRSKGRARKLATSNECVYGSYPEVPLEEMPDADGVASTLSLSIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLREIHSIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPGKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSAGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPL
KMEPQSPSEVKKLQKGSSESPFDLTTKRKDDKPLTPVPAKPPATPATSQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGEKKGANAEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMF
NFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDAYFTEIRNFIGDSNHSGQSPRNTEERMNGSHFKDEKALVTSQNSDLLDDEE
VEDEVLLDEEDEDNDIPGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEY
KTGLSALDHIRHFTDSLKMRKMEDNQYTEAEVSSFSASHVPEELKQPLHRKSKSQAYAMM
LSLSDKESLHSSSHSSSNVWHSMARAAAESSAIQSLSHV
NT seq 3720 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgtatatggcagc
taccctgaagttcctttggaagaaatgccagatgcagatggagtagccagcactctttcc
ctcagtattcaagagccatgctctccagccacgtccagcgaagcattcactccaaaggag
ggctctccttacaaagcccccatctacatccctgatgatatccccattcccgcggagttt
gagcttcgagagtcaaatatgcctggagcaggactaggaatatggaccaaaaggaaaatt
gaagcaggtgaaaagtttgggccttatgtgggagagcagaggtcaaacctgaaagacccc
agttatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcagcac
aacctcgttgcatgccagataaatgatcagatattttatagagtagtggcagacatcgcc
ccgggagaggagctcctgctgttcatgaagagtgaagactatccccatgaaactatggcg
ccagatatccacgaagaacggcagtaccgctgtgaggactgtgaccagctctttgagtcc
aaggctgagctagcggaccaccagaagttcccgtgcagcacccctcactcagcgttctcc
atggtggaagaggacttccaacaaaaactcgaaagtgaaaatgatctccgagagatacac
tcaatccaggagtgtaaggaatgtgaccaagtctttcctgatttgcaaagcctggagaaa
cacatgttgtcacatacggaagagagggagtacaagtgcgatcagtgtcccaaggcattt
aactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgaaaactgtgccaaggttttcacggaccctagcaacctgcagcggcacatccgctct
cagcacgttggtgcccgggcccacgcgtgcccggagtgtggcaaaacgtttgccacttcg
tcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgaggtc
tgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgctgat
tgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcctta
aataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggc
caaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatgagt
catgccaacccgggccttgctgactattttggcgccaatagacatcctgctggtcttacc
tttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttgtac
cacaggcctcctttgatacctgctagttctcctggtaaaggactatcaagtactgaacag
acaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacaggat
attttgaaggcactatctaaacacccacctgtaggggacaataagccagtggagctccag
cccgagaggtcctctgaagagaggccccttgaaaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtacaccaagtggcagtgacctggagacaacctcgggctctgat
ctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaa
gacaaagtaagccctcttcagaatctggcttcaatacataataagaaagaatacagcaat
cattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaatgat
tctataaaggctattgcttctattgctgaaaaatactttggttcagcaggactggtgggg
ctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccgtttttt
ccagcattctcccaatcaatgtacccatttcctgatagagacttgagatcgttacccttg
aaaatggaaccccaatcaccaagtgaagtaaagaaactgcagaagggaagctctgagtct
ccctttgatctcaccactaagcgcaaggacgacaagcccttgaccccagtacccgccaag
cctcctgcaacacccgccacaagccaagaccagcccctggatctaagcatgggcagtagg
agtagagccagtgggaccaagctcaccgagccccgtaaaaaccacgtgtttggggaaaag
aaaggagccaacgctgagccaagaccagcatctgatggttccttacagcatgctagaccc
actcccttctttatggaccctatttacagagtagagaaaagaaaactaactgacccactt
gaagctttaaaagagaaatacttgagaccgtctccaggattcctatttcacccacaattc
caactgcctgatcagagaacttggatgtcagccattgaaaacatggcagagaagctggag
agcttcagcgccctgaaacctgaggccagtgaacttctacagtcggttccctccatgttc
aacttcagagctcctcccaacgccctgccagagaacctcctgcggaaaggaaaggaacgc
tatacttgcagatactgtggcaagatttttccaagatctgcgaatctaacacggcacttg
agaacccacacaggagagcagccttacagatgcaaatactgtgacagatcattcagcata
tcttctaacctgcagcggcacgttcgcaacatccacaataaggagaagccctttaagtgt
cacttatgtgataggtgttttggtcaacaaaccaacttagacagacacctaaagaaacac
gagaatgggaacatgtctggtacagcaacatcgtcgcctcattctgagctggaaagcacg
ggtgcgattctcgatgacaaggaagatgcttacttcacagaaatccgaaatttcattggg
gacagcaaccacagcggccagtctccccggaacacagaggagagaatgaatggcagtcac
tttaaagatgaaaaggctttggtgaccagtcaaaattcggatttactggatgatgaagaa
gtagaagatgaggtgttattagatgaggaggatgaagacaatgatattcctgggaagaca
ggaaaggaaccagtgacaagtaacttacacgaaggaaaccccgaggatgactatgaagaa
accagcgccctggagatgagttgcaagacatccccagtgaggtataaagaggaagaatat
aaaactggactttctgctctagatcatatcaggcacttcacagatagcctcaaaatgagg
aaaatggaagataatcaatacactgaagctgaggtgtcttctttcagtgcttcccatgtg
ccagaggaacttaaacagccgttacacagaaagtccaaatcacaggcatatgctatgatg
ctatcattgtccgacaaggagtccctccactcttcatcccacagttcctccaacgtgtgg
cacagcatggccagggctgcagcggaatccagcgccatccagtccctgagccacgtatga

DBGET integrated database retrieval system