KEGG   Camelus ferus (Wild Bactrian camel): 102519252
Entry
102519252         CDS       T02979                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X2
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00310  Lysine degradation
cfr01100  Metabolic pathways
cfr04010  MAPK signaling pathway
cfr05200  Pathways in cancer
cfr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102519252 (MECOM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102519252 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102519252 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102519252 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102519252 (MECOM)
   03036 Chromosome and associated proteins [BR:cfr03036]
    102519252 (MECOM)
Enzymes [BR:cfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     102519252 (MECOM)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    102519252 (MECOM)
Chromosome and associated proteins [BR:cfr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102519252 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 Zn-ribbon_8 zf-met zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 102519252
NCBI-ProteinID: XP_014417569
LinkDB
Position
1
AA seq 1239 aa
MRSKGRARKLATSNECVYGSYPEVPLEEMPDADGVASTLSLSIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLREIHSIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPGKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSAGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPL
KMEPQSPSEVKKLQKGSSESPFDLTTKRKDDKPLTPVPAKPPATPATSQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGEKKGANAEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMF
NFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDAYFTEIRNFIGDSNHSGQSPRNTEERMNGSHFKDEKALVTSQNSDLLDDEE
VEDEVLLDEEDEDNDIPGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEY
KTGLSALDHIRHFTDSLKMRKMEDNQYTEAEVSSFSASHVPEELKQPLHRKSKSQAYAMM
LSLSDKESLHSSSHSSSNVWHSMARAAAESSAIQSLSHV
NT seq 3720 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgtatatggcagc
taccctgaagttcctttggaagaaatgccagatgcagatggagtagccagcactctttcc
ctcagtattcaagagccatgctctccagccacgtccagcgaagcattcactccaaaggag
ggctctccttacaaagcccccatctacatccctgatgatatccccattcccgcggagttt
gagcttcgagagtcaaatatgcctggagcaggactaggaatatggaccaaaaggaaaatt
gaagcaggtgaaaagtttgggccttatgtgggagagcagaggtcaaacctgaaagacccc
agttatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcagcac
aacctcgttgcatgccagataaatgatcagatattttatagagtagtggcagacatcgcc
ccgggagaggagctcctgctgttcatgaagagtgaagactatccccatgaaactatggcg
ccagatatccacgaagaacggcagtaccgctgtgaggactgtgaccagctctttgagtcc
aaggctgagctagcggaccaccagaagttcccgtgcagcacccctcactcagcgttctcc
atggtggaagaggacttccaacaaaaactcgaaagtgaaaatgatctccgagagatacac
tcaatccaggagtgtaaggaatgtgaccaagtctttcctgatttgcaaagcctggagaaa
cacatgttgtcacatacggaagagagggagtacaagtgcgatcagtgtcccaaggcattt
aactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgaaaactgtgccaaggttttcacggaccctagcaacctgcagcggcacatccgctct
cagcacgttggtgcccgggcccacgcgtgcccggagtgtggcaaaacgtttgccacttcg
tcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgaggtc
tgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgctgat
tgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcctta
aataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggc
caaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatgagt
catgccaacccgggccttgctgactattttggcgccaatagacatcctgctggtcttacc
tttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttgtac
cacaggcctcctttgatacctgctagttctcctggtaaaggactatcaagtactgaacag
acaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacaggat
attttgaaggcactatctaaacacccacctgtaggggacaataagccagtggagctccag
cccgagaggtcctctgaagagaggccccttgaaaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtacaccaagtggcagtgacctggagacaacctcgggctctgat
ctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaa
gacaaagtaagccctcttcagaatctggcttcaatacataataagaaagaatacagcaat
cattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaatgat
tctataaaggctattgcttctattgctgaaaaatactttggttcagcaggactggtgggg
ctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccgtttttt
ccagcattctcccaatcaatgtacccatttcctgatagagacttgagatcgttacccttg
aaaatggaaccccaatcaccaagtgaagtaaagaaactgcagaagggaagctctgagtct
ccctttgatctcaccactaagcgcaaggacgacaagcccttgaccccagtacccgccaag
cctcctgcaacacccgccacaagccaagaccagcccctggatctaagcatgggcagtagg
agtagagccagtgggaccaagctcaccgagccccgtaaaaaccacgtgtttggggaaaag
aaaggagccaacgctgagccaagaccagcatctgatggttccttacagcatgctagaccc
actcccttctttatggaccctatttacagagtagagaaaagaaaactaactgacccactt
gaagctttaaaagagaaatacttgagaccgtctccaggattcctatttcacccacaattc
caactgcctgatcagagaacttggatgtcagccattgaaaacatggcagagaagctggag
agcttcagcgccctgaaacctgaggccagtgaacttctacagtcggttccctccatgttc
aacttcagagctcctcccaacgccctgccagagaacctcctgcggaaaggaaaggaacgc
tatacttgcagatactgtggcaagatttttccaagatctgcgaatctaacacggcacttg
agaacccacacaggagagcagccttacagatgcaaatactgtgacagatcattcagcata
tcttctaacctgcagcggcacgttcgcaacatccacaataaggagaagccctttaagtgt
cacttatgtgataggtgttttggtcaacaaaccaacttagacagacacctaaagaaacac
gagaatgggaacatgtctggtacagcaacatcgtcgcctcattctgagctggaaagcacg
ggtgcgattctcgatgacaaggaagatgcttacttcacagaaatccgaaatttcattggg
gacagcaaccacagcggccagtctccccggaacacagaggagagaatgaatggcagtcac
tttaaagatgaaaaggctttggtgaccagtcaaaattcggatttactggatgatgaagaa
gtagaagatgaggtgttattagatgaggaggatgaagacaatgatattcctgggaagaca
ggaaaggaaccagtgacaagtaacttacacgaaggaaaccccgaggatgactatgaagaa
accagcgccctggagatgagttgcaagacatccccagtgaggtataaagaggaagaatat
aaaactggactttctgctctagatcatatcaggcacttcacagatagcctcaaaatgagg
aaaatggaagataatcaatacactgaagctgaggtgtcttctttcagtgcttcccatgtg
ccagaggaacttaaacagccgttacacagaaagtccaaatcacaggcatatgctatgatg
ctatcattgtccgacaaggagtccctccactcttcatcccacagttcctccaacgtgtgg
cacagcatggccagggctgcagcggaatccagcgccatccagtccctgagccacgtatga

KEGG   Camelus ferus (Wild Bactrian camel): 102521748
Entry
102521748         CDS       T02979                                 

Gene name
RUNX1
Definition
(RefSeq) runt-related transcription factor 1 isoform X1
  KO
K08367  runt-related transcription factor 1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04530  Tight junction
cfr04659  Th17 cell differentiation
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05220  Chronic myeloid leukemia
cfr05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102521748 (RUNX1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102521748 (RUNX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102521748 (RUNX1)
   05202 Transcriptional misregulation in cancer
    102521748 (RUNX1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102521748 (RUNX1)
   05220 Chronic myeloid leukemia
    102521748 (RUNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102521748 (RUNX1)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    102521748 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 102521748
NCBI-ProteinID: XP_032326432
LinkDB
Position
1
AA seq 467 aa
MASDSIFESFPSYPQCFMRDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRS
GDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVM
AGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAI
KITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASL
NHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTL
SAELSSRLSTASDLTAFGDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMSS
ATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCT
NASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatatttgagtcatttccttcatacccacagtgcttcatgagagat
gccagcacgagccgccgcttcacgccgccttccaccgcgctgagcccgggcaagatgagc
gaggcgctgccgctgggcgccccggacgccggcgccgccctggccggcaagctgaggagc
ggcgaccgcagcatggtggaggtgctggccgaccacccgggcgagctggtgcgcaccgac
agccccaacttcctctgctctgtgctgcccacgcactggcgctgcaacaagaccctgccc
atcgctttcaaggtggtggctctgggggacgttccagatggcactctggtcactgtgatg
gcaggcaatgatgaaaactactcagccgaactgagaaatgcaacagcagccatgaaaaac
caagttgcaagattcaatgacctcaggtttgtcggtcggagtggaagagggaagagcttc
acgttgaccatcaccgtcttcacaaacccaccgcaagttgccacctaccacagagccatc
aaaatcacagtggacggaccccgagaacctcgaagacatcgtcagaaactagatgatcag
accaagcccgggagcttgtccttttccgagcggctcagtgagttggagcagctgcggcgc
acggccatgagggtcagcccacaccacccagcccccacacccaaccctcgggcctccttg
aaccactccactgcctttaaccctcagcctcagagtcagatgcaggataccaggcagatc
cagccatcccctccgtggtcctatgatcagtcctaccagtacctggggtctatcgcctct
ccctctgtacacccggcaacacccatctcgcctggacgcgccagcggcatgacaaccctc
tctgcagagctttccagtcgactctcaaccgcgtccgacctgacggccttcggcgacccg
cgccaattccccgcgctgccctccatctcagacccacgcatgcactaccccggcgccttc
acctactccccgacgcccgtcacgtcgggcatcggcatcggcatgtcggccatgagctcg
gccacgcgctaccacacgtacctgccgccgccctaccccggctcgtcgcaggcgcagggc
ggcccattccaggccagctcgccgtcctaccacctgtactacggcgcgtcggccggctcc
taccagttctccatggtgggcggcgagcgctcgccgccgcgcatccttccgccctgcacc
aacgcctccaccggctcggcgctgctcaaccccagcctcccgaaccagagcgacgtagtg
gaggccgagggcagccacagcaactcccccaccaacatggcgcccgccgcgcgactcgag
gaggccgtgtggcggccctactga

DBGET integrated database retrieval system