KEGG   Camelus ferus (Wild Bactrian camel): 102519409
Entry
102519409         CDS       T02979                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04064  NF-kappa B signaling pathway
cfr04210  Apoptosis
cfr04380  Osteoclast differentiation
cfr04620  Toll-like receptor signaling pathway
cfr04621  NOD-like receptor signaling pathway
cfr04622  RIG-I-like receptor signaling pathway
cfr04623  Cytosolic DNA-sensing pathway
cfr04625  C-type lectin receptor signaling pathway
cfr04657  IL-17 signaling pathway
cfr04658  Th1 and Th2 cell differentiation
cfr04659  Th17 cell differentiation
cfr04660  T cell receptor signaling pathway
cfr04662  B cell receptor signaling pathway
cfr04668  TNF signaling pathway
cfr04722  Neurotrophin signaling pathway
cfr04920  Adipocytokine signaling pathway
cfr04926  Relaxin signaling pathway
cfr04931  Insulin resistance
cfr05132  Salmonella infection
cfr05134  Legionellosis
cfr05135  Yersinia infection
cfr05140  Leishmaniasis
cfr05142  Chagas disease
cfr05145  Toxoplasmosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05171  Coronavirus disease - COVID-19
cfr05200  Pathways in cancer
cfr05203  Viral carcinogenesis
cfr05215  Prostate cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102519409 (NFKBIA)
   04668 TNF signaling pathway
    102519409 (NFKBIA)
   04024 cAMP signaling pathway
    102519409 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102519409 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102519409 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    102519409 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    102519409 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    102519409 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    102519409 (NFKBIA)
   04660 T cell receptor signaling pathway
    102519409 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    102519409 (NFKBIA)
   04659 Th17 cell differentiation
    102519409 (NFKBIA)
   04657 IL-17 signaling pathway
    102519409 (NFKBIA)
   04662 B cell receptor signaling pathway
    102519409 (NFKBIA)
   04062 Chemokine signaling pathway
    102519409 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102519409 (NFKBIA)
   04926 Relaxin signaling pathway
    102519409 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102519409 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102519409 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102519409 (NFKBIA)
   05203 Viral carcinogenesis
    102519409 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102519409 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102519409 (NFKBIA)
   05215 Prostate cancer
    102519409 (NFKBIA)
   05222 Small cell lung cancer
    102519409 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102519409 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102519409 (NFKBIA)
   05135 Yersinia infection
    102519409 (NFKBIA)
   05134 Legionellosis
    102519409 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102519409 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    102519409 (NFKBIA)
   05161 Hepatitis B
    102519409 (NFKBIA)
   05160 Hepatitis C
    102519409 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    102519409 (NFKBIA)
   05164 Influenza A
    102519409 (NFKBIA)
   05162 Measles
    102519409 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    102519409 (NFKBIA)
   05163 Human cytomegalovirus infection
    102519409 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102519409 (NFKBIA)
   05169 Epstein-Barr virus infection
    102519409 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102519409 (NFKBIA)
   05140 Leishmaniasis
    102519409 (NFKBIA)
   05142 Chagas disease
    102519409 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfr03000]
    102519409 (NFKBIA)
   04131 Membrane trafficking [BR:cfr04131]
    102519409 (NFKBIA)
Transcription factors [BR:cfr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    102519409 (NFKBIA)
Membrane trafficking [BR:cfr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102519409 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 102519409
NCBI-ProteinID: XP_032337779
LinkDB
Position
6
AA seq 314 aa
MFQPAEPGHEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEVLLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTRQTQHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcccgccgagcccggccacgagtgggccatggagggccctcgggatgcgctc
aagaaggagcggctgctggacgaccgccacgatagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgggagatccgcctcgagcctcaggaggcgccg
cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttccttcacttg
gccatcatccatgaagagaaggcactgaccatggaagtagtccgccaagtaaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccagaaattgctgaggtacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcagacccgccagacccagcacctccactccattctgcaggccaccaac
tacaatggccacacgtgtctgcacttagcctctatccacggctacctgggcatcgtggag
ctgttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaacggccgaaccgcc
ctccatcttgcagtggacctgcagaatccagacctggtgtcgctcttgttgaagtgtgga
gctgatgtcaacagagtcacctaccagggctactccccataccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccaactgacactagagaaccttcagatgctg
ccagagagcgaggatgaggagagctatgacacagagtcagagttcacagaggacgagctg
ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system