KEGG   Camelus ferus (Wild Bactrian camel): 102520308
Entry
102520308         CDS       T02979                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04014  Ras signaling pathway
cfr04390  Hippo signaling pathway
cfr04392  Hippo signaling pathway - multiple species
cfr05200  Pathways in cancer
cfr05206  MicroRNAs in cancer
cfr05219  Bladder cancer
cfr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102520308 (RASSF1)
   04390 Hippo signaling pathway
    102520308 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102520308 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102520308 (RASSF1)
   05206 MicroRNAs in cancer
    102520308 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102520308 (RASSF1)
   05223 Non-small cell lung cancer
    102520308 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH
Other DBs
NCBI-GeneID: 102520308
NCBI-ProteinID: XP_006174150
UniProt: T0NH47
LinkDB
Position
17
AA seq 272 aa
MGEADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETP
DLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDA
RRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggcgaggcggacgcggggacgccttctttcgagatgacctggagcagcacaacaagc
agtggctactgcagccaggaggactccgactcagagctcgagcagtacttcaccgcgcgt
acctcgctggcgcgcaggccgcgccgggaccaggatgagcctgtggagtgggagactcct
gacctttctcaggctgagattgagcagaagatcaaggagtacaatggccagatcaacagc
aacctgttcatgagcctgaacaaggatggctcctacacaggcttcatcaaggttcaactg
aagctggtgcgccctgtctcggttccctccagcaagaaaccaccctccttgcaggatgcc
cggcggggcccagggcggggcacagctgtgaaacggcgcacttccttctacttgcccaag
gatgctgtcaagcacctgcatgtgttgtcacgcacgcgggcacgcgaggtcatcgaggcc
ctgctgcgcaaattcttggtggtggatgacccccgcaagtttgcactctttgagcgggct
gagcgccatggccaagtgtacctgcggaagctgtcagatgatgagcagcccctgcggctc
cggctccttgcaggacccagtgagaaggccctcagctttgtcctgaaggagaatgactct
ggggaggtgaactgggatgctttcagcatgcctgaactacacaacttcctgcgcatcctg
cagcgggaagaagaggaacacctccgccagatcctgcagaagtactcctattgccgccag
aagatccaagaggccctgcatgcctgccccctggggtga

DBGET integrated database retrieval system